BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30353 (742 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 24 1.1 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 24 1.1 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 3.4 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +2 Query: 110 YNIINYSFVSIVSFGLW*ECEYLLNKSYLIIN 205 ++++++ VS + G E + LL +SYLII+ Sbjct: 120 FDMLSHVDVSFIKAGFRLEYKQLLKRSYLIIS 151 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +2 Query: 110 YNIINYSFVSIVSFGLW*ECEYLLNKSYLIIN 205 ++++++ VS + G E + LL +SYLII+ Sbjct: 120 FDMLSHVDVSFIKAGFRLEYKQLLKRSYLIIS 151 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 557 IYRCSCRSYERFLFQYL*SIWSRMRKCGKKFEL 655 I++ R YE F +L + WS R+ +F++ Sbjct: 198 IFQKKWRGYEDFRRDFLRTYWSAKRQRDIRFQI 230 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,278 Number of Sequences: 336 Number of extensions: 3223 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -