BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30353 (742 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1056 - 33804717-33804871,33805352-33805418,33805508-338055... 29 5.1 >02_05_1056 - 33804717-33804871,33805352-33805418,33805508-33805576, 33806414-33806548,33806609-33806680,33807281-33807375, 33807778-33807859,33807949-33807999,33808107-33808187, 33808534-33808575,33808705-33808803,33809044-33809115, 33809166-33809270 Length = 374 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -2 Query: 165 SHQRPKDTMETKL*LIILYSHIPSCKTAVSVDSKR 61 + QRP + + L++L HIP CK + ++D +R Sbjct: 6 ARQRPSVAAKQEKVLLVLILHIPYCKYSQAIDLQR 40 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,591,403 Number of Sequences: 37544 Number of extensions: 262422 Number of successful extensions: 407 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 407 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -