BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30352 (581 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.5 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 23 2.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 91 WGRLKFFFCFDGVFHDPNK 35 WG+ + F C G+ D NK Sbjct: 1299 WGKYEVFNCAPGLHWDNNK 1317 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 22.6 bits (46), Expect = 2.5 Identities = 13/42 (30%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 13 PHSAGLTPY--SGHGRHHQNKRRTSTCPNRRXPTLTSHVFSS 132 P S G++PY S H HH R P ++SS Sbjct: 40 PLSLGMSPYASSQHHHHHLQARPPQDSPYDASVAAACKLYSS 81 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,274 Number of Sequences: 336 Number of extensions: 1680 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -