BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30352 (581 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0578 + 4295386-4296489,4297394-4297507 91 8e-19 03_06_0298 - 32925441-32925998,32926371-32926730,32927161-329272... 88 6e-18 08_02_1293 - 25945888-25946026,25946257-25946315,25946458-259465... 30 1.2 11_01_0373 + 2826646-2826676,2827010-2827268,2828325-2828415 29 2.0 02_04_0073 - 19471254-19472681 29 2.7 03_05_1101 - 30408944-30410410 28 6.2 >07_01_0578 + 4295386-4296489,4297394-4297507 Length = 405 Score = 90.6 bits (215), Expect = 8e-19 Identities = 40/85 (47%), Positives = 60/85 (70%) Frame = +3 Query: 3 WTQSAFGRLDPLFGSWKTPSKQKKNFNLPQPKXANTNLTRLLKSDEIRKVLRAPNKRVIR 182 WT+SAF +L+ ++G+++ PS +KK F LP+PK AN +L R++ SDE++ V++ NK V R Sbjct: 257 WTESAFKKLEEVYGTFEAPSLKKKGFILPRPKMANADLGRIINSDEVQSVVKPLNKEVKR 316 Query: 183 ATRKLNPLTNNKAMLKLNPYAAVLR 257 ++ NPL N A+LKLNPY R Sbjct: 317 REKRKNPLKNVAAVLKLNPYFGTAR 341 >03_06_0298 - 32925441-32925998,32926371-32926730,32927161-32927230, 32927642-32927797,32929181-32929242,32929339-32929352, 32930421-32930520,32931474-32932574 Length = 806 Score = 87.8 bits (208), Expect = 6e-18 Identities = 40/85 (47%), Positives = 57/85 (67%) Frame = +3 Query: 3 WTQSAFGRLDPLFGSWKTPSKQKKNFNLPQPKXANTNLTRLLKSDEIRKVLRAPNKRVIR 182 WT+ AF +LD ++G + TP+ +KK F LP+PK AN +L+RL+ SDE++ V++ NK V Sbjct: 256 WTECAFKKLDEVYGGFDTPALKKKGFVLPRPKMANADLSRLINSDEVQSVVKPINKEVKL 315 Query: 183 ATRKLNPLTNNKAMLKLNPYAAVLR 257 + NPL N A+LKLNPY R Sbjct: 316 REARRNPLKNVAAVLKLNPYFGTAR 340 >08_02_1293 - 25945888-25946026,25946257-25946315,25946458-25946543, 25946800-25946845,25946953-25947405 Length = 260 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 215 QGDAETQSLRGRAE-RKAILELRRRKNLKALADAEKSGLKLYKRNPA 352 +GD + QSL RA R+A L RRR+ + + G+ + R PA Sbjct: 42 EGDEDGQSLSARARGRRARLSARRRERIVVVEGGGVGGIGEFLRQPA 88 >11_01_0373 + 2826646-2826676,2827010-2827268,2828325-2828415 Length = 126 Score = 29.5 bits (63), Expect = 2.0 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = +2 Query: 248 RAERKAILELRRRKNLKALADAEKSGLKLYKRNPAMKAEKLRERRRK 388 RAE K ILELR++ KA A +K K K+N K +K +++++K Sbjct: 33 RAELKKILELRKK---KAKAKVKKKPKK--KKNKKAKKKKKKKKKKK 74 >02_04_0073 - 19471254-19472681 Length = 475 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 10 SPHSAGLTPYSGHGRHHQNKRRTSTCPNRRXPTLTSHVFSSLMR 141 +P G +P S HG HH++++ T N + L V ++R Sbjct: 20 APRPRGASPLSSHGHHHRSRKIHRTFNNVKITVLCGLVTILVLR 63 >03_05_1101 - 30408944-30410410 Length = 488 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 539 ALGLSSALGLWPWVSRPFQLSASYLPSSWEE 447 ALGL ++ + WV RP S + P WE+ Sbjct: 304 ALGLEASNHPFLWVIRPEDSSGRWAPEGWEQ 334 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,017,973 Number of Sequences: 37544 Number of extensions: 206871 Number of successful extensions: 624 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 623 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1364465340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -