BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30352 (581 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2435| Best HMM Match : WD40 (HMM E-Value=4.1e-10) 32 0.30 SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 31 0.69 SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_48059| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 >SB_2435| Best HMM Match : WD40 (HMM E-Value=4.1e-10) Length = 1272 Score = 32.3 bits (70), Expect = 0.30 Identities = 20/54 (37%), Positives = 30/54 (55%) Frame = +2 Query: 215 QGDAETQSLRGRAERKAILELRRRKNLKALADAEKSGLKLYKRNPAMKAEKLRE 376 Q +AE + L ERKA+L R ++ A+ DAE L+L + ++ E LRE Sbjct: 737 QREAELRRLDDEIERKALL--REQETQAAVEDAEIKALELQAQKEMLQQELLRE 788 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 31.1 bits (67), Expect = 0.69 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 180 RATRKLNPLTNNKAMLKLNPYA 245 RA K NPL N ML+LNPYA Sbjct: 250 RAIHKKNPLKNLGTMLRLNPYA 271 >SB_14316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +3 Query: 129 KSDEIRKVLRAPNKRV---IRATRKLNPLTNNKAMLKL 233 +SD I K+ NK++ ++ L+ LTNNKA LKL Sbjct: 27 QSDVIHKIPNEANKQIGLRVKCLALLDYLTNNKAQLKL 64 >SB_54601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1718 Score = 28.7 bits (61), Expect = 3.7 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 5/85 (5%) Frame = +3 Query: 54 TPSKQKKNFNLPQPKXANTNLTRLLKSDEIRKVLRAPNKRVIRATRKLN-----PLTNNK 218 TP++Q F + + +N +++RL S+ + ++ N RVI+++ N NN+ Sbjct: 802 TPTEQDAEFTANEAEVSNQDISRLSSSEPSPIIPKSINNRVIKSSALSNGEQWESGNNNE 861 Query: 219 AMLKLNPYAAVLRGKLS*SCAEGRT 293 + + L R LS S EG T Sbjct: 862 SNVVLRKKKFGRRKWLSFSMVEGGT 886 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.3 bits (60), Expect = 4.8 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +2 Query: 218 GDAETQSLRGRAERKAILELRRRKNLKA-LADAEKSGLKLYKRNPAMKAEKLRERRRKN 391 G + S RGR ++ +RRR++ +SG + +R+P+ E+ RER N Sbjct: 108 GGGRSPSPRGRRRSRSRSPVRRRRSPSLERRSRSRSGSRERRRSPSRSPERRRERSFSN 166 >SB_48059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 27.9 bits (59), Expect = 6.4 Identities = 22/59 (37%), Positives = 30/59 (50%) Frame = +3 Query: 207 TNNKAMLKLNPYAAVLRGKLS*SCAEGRT*RLLLMPRRVD*SCISETPL*RLRNYARGD 383 T + L +NPY RG ++ C T RLL+ P RVD +C + + L N RGD Sbjct: 5 TVHTVRLLINPY----RGDMA--CKTVHTVRLLINPYRVDMACKTVHTVRLLINPYRGD 57 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,500,390 Number of Sequences: 59808 Number of extensions: 223944 Number of successful extensions: 929 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 925 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -