BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30352 (581 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 26 1.0 DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide... 25 2.4 Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor pr... 23 5.5 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 9.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 9.5 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 9.5 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 25.8 bits (54), Expect = 1.0 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 6/59 (10%) Frame = +3 Query: 42 GSWKTPSKQKKNFNLPQP------KXANTNLTRLLKSDEIRKVLRAPNKRVIRATRKLN 200 G K P K+KK +LP+P K N +L ++LK L+ +V + R N Sbjct: 153 GQSKQPKKKKKKRSLPKPEAVVIEKCENIDLAKVLKGLTHDDALKDVGDQVAKVRRTQN 211 >DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide F prepropeptide protein. Length = 234 Score = 24.6 bits (51), Expect = 2.4 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 10/63 (15%) Frame = +3 Query: 18 FGRLDPLFGSWKTPSKQKKNFNLPQPK------XANT--NLTRLLKSDEI--RKVLRAPN 167 FGR DPL+ S+ + ++NF P +N NL + D++ +K +RAP Sbjct: 101 FGRNDPLWTSFNENALLEENFEKRAPSQRLRWGRSNLFGNLVNQFQQDDVMQQKTIRAPQ 160 Query: 168 KRV 176 R+ Sbjct: 161 LRL 163 >Z69981-1|CAA93821.1| 327|Anopheles gambiae maltase precursor protein. Length = 327 Score = 23.4 bits (48), Expect = 5.5 Identities = 18/69 (26%), Positives = 31/69 (44%) Frame = +2 Query: 161 SQQTRDPCYTQIEPTH**QGDAETQSLRGRAERKAILELRRRKNLKALADAEKSGLKLYK 340 ++++RDPC T + A G + + R N++A AEKS LK+Y+ Sbjct: 150 AEKSRDPCRTPFQW----DDPAMAGFTTGSKTWLPVGDRYREVNVQAQLAAEKSHLKVYQ 205 Query: 341 RNPAMKAEK 367 ++ K Sbjct: 206 SMMELRKTK 214 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 9.5 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 567 PLKNLFIYLRLRLIISFRL 511 PLK+L++ L LRL + RL Sbjct: 2182 PLKSLYLMLELRLPLVCRL 2200 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 9.5 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 567 PLKNLFIYLRLRLIISFRL 511 PLK+L++ L LRL + RL Sbjct: 2183 PLKSLYLMLELRLPLVCRL 2201 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 22.6 bits (46), Expect = 9.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 551 LFIYALGLSSALGLWPWVSRPFQ 483 LF Y G+SS L +W V+ F+ Sbjct: 113 LFTYTSGVSSFLSVWYVVAFTFE 135 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 442,876 Number of Sequences: 2352 Number of extensions: 6765 Number of successful extensions: 22 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -