BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30352 (581 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 26 0.24 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 1.7 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 2.2 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 8.9 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.9 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 26.2 bits (55), Expect = 0.24 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 84 LPQPKXANTNLTRLLKSDEIRKVLRAPNKRV 176 LP P N L L+ S E+R+ +APN V Sbjct: 490 LPPPYRLNKPLMSLITSSEVRQPGKAPNYSV 520 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.4 bits (48), Expect = 1.7 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +1 Query: 16 HSAGLTPYSGHGRHHQNKRRTSTCPNRRXPTLTSHVFSSLMRS 144 H+ G T H HH + R+ PTL S +SS + S Sbjct: 341 HTMGPTMGPPHHHHHHQTQSLQHLHYRQPPTL-SESYSSYVNS 382 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.0 bits (47), Expect = 2.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 3 WTQSAFGRLDPLFGSWKTPSKQKKNFNLP 89 WT ++ P G +KT SK F+LP Sbjct: 32 WTATSHEASAPAEGKFKTVSKVPGPFSLP 60 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +1 Query: 37 YSGHGRHHQNKRRTSTC 87 YS + HH R S+C Sbjct: 435 YSAYSLHHVRSSRESSC 451 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.0 bits (42), Expect = 8.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 242 RGRAERKAILELRRRKNLKALADAEKSGLKLYKR 343 +GR ++ + RR+ + K +A A K KL+ R Sbjct: 429 KGRDKKSTSKKPRRKFHFKQIARAVKFTSKLFGR 462 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,731 Number of Sequences: 438 Number of extensions: 1890 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -