BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30352 (581 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 85 2e-17 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 80 9e-16 At5g56890.1 68418.m07099 protein kinase family protein contains ... 28 5.2 At1g30950.1 68414.m03790 unusual floral organ (UFO) / F-box fami... 28 5.2 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 85.4 bits (202), Expect = 2e-17 Identities = 39/81 (48%), Positives = 55/81 (67%) Frame = +3 Query: 3 WTQSAFGRLDPLFGSWKTPSKQKKNFNLPQPKXANTNLTRLLKSDEIRKVLRAPNKRVIR 182 WT+SAF +L+ ++GS++ PS++KK + LP+ K N +L R++ SDEI+ V+ K R Sbjct: 258 WTKSAFEKLESIYGSFEKPSEKKKGYVLPRAKMVNADLARIINSDEIQSVVNPIKKDAKR 317 Query: 183 ATRKLNPLTNNKAMLKLNPYA 245 A K NPL N MLKLNPYA Sbjct: 318 AVLKKNPLKNLNVMLKLNPYA 338 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 80.2 bits (189), Expect = 9e-16 Identities = 36/81 (44%), Positives = 53/81 (65%) Frame = +3 Query: 3 WTQSAFGRLDPLFGSWKTPSKQKKNFNLPQPKXANTNLTRLLKSDEIRKVLRAPNKRVIR 182 WT+SAF +L+ ++GS++ PS++KK + LP+ K N +L R++ SDE++ V+ R Sbjct: 259 WTKSAFEKLESIYGSFEKPSEKKKGYVLPRAKMVNADLARIINSDEVQSVVNPIKDGSKR 318 Query: 183 ATRKLNPLTNNKAMLKLNPYA 245 A K NPL N M KLNPYA Sbjct: 319 AVLKKNPLKNLNVMFKLNPYA 339 >At5g56890.1 68418.m07099 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 1113 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +1 Query: 13 PHSAGLTPYSGHGRHHQNKRRTSTCPNRRXPTLTSHVFSSLMRSGRSSVLP 165 P S P S H +HHQ +++ + P L H+ S + + S+ P Sbjct: 335 PSSPSPPPLSSHHQHHQERKKIADSP--APSPLPPHLISPKKSNRKGSMTP 383 >At1g30950.1 68414.m03790 unusual floral organ (UFO) / F-box family protein (FBX1) E3 ubiquitin ligase SCF complex F-box subunit; almost identical to unusual floral organs (UFO)GI:4376159 from [Arabidopsis thaliana] Landsberg-erecta; one amino acid difference Length = 442 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 494 RPFQLSASYLPSSWEEAGSS*QPASWVS 411 R ++LS +Y+PS + +GSS SWVS Sbjct: 138 RWYRLSFAYIPSGFYPSGSSGGLVSWVS 165 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,603,762 Number of Sequences: 28952 Number of extensions: 162145 Number of successful extensions: 491 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1141585696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -