BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30351 (501 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1294 - 36076524-36076554,36076821-36076891,36077221-360772... 79 1e-15 05_05_0108 + 22451440-22451541,22452228-22452427,22452979-22453018 78 3e-15 09_01_0024 + 438288-438542,439020-439069,440096-440351 29 2.8 08_02_0340 + 15981210-15981467 28 3.7 11_02_0038 - 7631462-7634428,7635975-7636250 27 6.4 >01_06_1294 - 36076524-36076554,36076821-36076891,36077221-36077275, 36077363-36077562,36078614-36078715 Length = 152 Score = 79.4 bits (187), Expect = 1e-15 Identities = 40/69 (57%), Positives = 48/69 (69%) Frame = -2 Query: 302 KGSSNETLQVCP*FSTEVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREE 123 KG S + + EVVG A YEKR ELLKV KDKRALK KR+LGTH RAK+KREE Sbjct: 33 KGKSTKRVNFVRGLIREVVGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREE 92 Query: 122 LSNVLAQMR 96 ++ V+ +MR Sbjct: 93 MAGVIRKMR 101 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 340 ITDKAIRIRPARLKGLQTKHSKFVRDLVRKL 248 +T + + RP+ KG TK FVR L+R++ Sbjct: 20 VTKRELPPRPSDRKGKSTKRVNFVRGLIREV 50 >05_05_0108 + 22451440-22451541,22452228-22452427,22452979-22453018 Length = 113 Score = 78.2 bits (184), Expect = 3e-15 Identities = 40/69 (57%), Positives = 47/69 (68%) Frame = -2 Query: 302 KGSSNETLQVCP*FSTEVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREE 123 KG S + + EV G A YEKR ELLKV KDKRALK KR+LGTH RAK+KREE Sbjct: 33 KGKSTKRVTFVRNLIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKKKREE 92 Query: 122 LSNVLAQMR 96 ++ VL +MR Sbjct: 93 MAGVLRKMR 101 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 340 ITDKAIRIRPARLKGLQTKHSKFVRDLVRKLS 245 +T + + RP+ KG TK FVR+L+R+++ Sbjct: 20 VTKRELPPRPSDRKGKSTKRVTFVRNLIREVA 51 >09_01_0024 + 438288-438542,439020-439069,440096-440351 Length = 186 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = -2 Query: 239 AQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSN 114 A++E R E LK ++++ A K LKR+ + ++KR + +N Sbjct: 122 AEFELRREERLKEAEERTAKKRLKRQKKKQRKKEKKRSKTNN 163 >08_02_0340 + 15981210-15981467 Length = 85 Score = 28.3 bits (60), Expect = 3.7 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = -3 Query: 454 LVPNSAPGQSEIMAPRFEIAVGLRKGLKTTKISAGRKGITDKAIRIRPARLKGLQ 290 L G + + P +E R+G+K + G G+T +A R R + L+ LQ Sbjct: 32 LAAEGVDGDTSVCCPAWERRED-REGIKDAGLVCGGDGVTSEADRTRRSMLRPLQ 85 >11_02_0038 - 7631462-7634428,7635975-7636250 Length = 1080 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 194 DKRALKFLKRRLGTHIRAKRKREELSNV 111 DK+ LKFL R TH + E+++N+ Sbjct: 791 DKKHLKFLNLRCTTHTKESYTMEDITNI 818 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,814,351 Number of Sequences: 37544 Number of extensions: 203069 Number of successful extensions: 494 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 494 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -