BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30351 (501 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR533465-1|CAG38496.1| 105|Homo sapiens RPL36 protein. 95 9e-20 BC091508-1|AAH91508.1| 105|Homo sapiens ribosomal protein L36 p... 95 9e-20 BC004971-1|AAH04971.1| 105|Homo sapiens ribosomal protein L36 p... 95 9e-20 BC003052-1|AAH03052.1| 105|Homo sapiens ribosomal protein L36 p... 95 9e-20 AB061833-1|BAB79471.1| 105|Homo sapiens ribosomal protein L36 p... 95 9e-20 AB046410-1|BAB21256.1| 32|Homo sapiens ribosomal protein L36 p... 64 3e-10 Z99496-8|CAM28259.1| 394|Homo sapiens chromosome 6 open reading... 30 5.2 Z99496-4|CAM28258.1| 576|Homo sapiens chromosome 6 open reading... 30 5.2 Z99496-3|CAI21606.2| 499|Homo sapiens chromosome 6 open reading... 30 5.2 Z99496-2|CAM28257.1| 489|Homo sapiens chromosome 6 open reading... 30 5.2 Z99496-1|CAI21605.1| 805|Homo sapiens chromosome 6 open reading... 30 5.2 BC126142-1|AAI26143.1| 457|Homo sapiens C6orf204 protein protein. 30 5.2 BC126140-1|AAI26141.1| 457|Homo sapiens C6orf204 protein protein. 30 5.2 BC110835-1|AAI10836.1| 394|Homo sapiens C6orf204 protein protein. 30 5.2 BC052778-1|AAH52778.1| 392|Homo sapiens C6orf204 protein protein. 30 5.2 BC048977-1|AAH48977.1| 392|Homo sapiens C6orf204 protein protein. 30 5.2 AY313778-1|AAP81009.1| 394|Homo sapiens serologically defined b... 30 5.2 AL589993-1|CAI16048.1| 805|Homo sapiens chromosome 6 open readi... 30 5.2 AL390069-4|CAM19612.1| 576|Homo sapiens chromosome 6 open readi... 30 5.2 AL390069-3|CAI14135.2| 499|Homo sapiens chromosome 6 open readi... 30 5.2 AL390069-2|CAM19611.1| 489|Homo sapiens chromosome 6 open readi... 30 5.2 AL390069-1|CAI14134.1| 805|Homo sapiens chromosome 6 open readi... 30 5.2 AF308284-1|AAG48252.1| 546|Homo sapiens serologically defined b... 30 5.2 >CR533465-1|CAG38496.1| 105|Homo sapiens RPL36 protein. Length = 105 Score = 95.5 bits (227), Expect = 9e-20 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 254 EVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 93 EV G A YE+RAMELLKVSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 46 EVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 41.5 bits (93), Expect = 0.002 Identities = 27/75 (36%), Positives = 38/75 (50%) Frame = -3 Query: 418 MAPRFEIAVGLRKGLKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVRKLSDT 239 MA R+ +AVGL KG K TK + R +R +G TKH+KFVRD++R++ Sbjct: 1 MALRYPMAVGLNKGHKVTK----------NVSKPRHSRRRGRLTKHTKFVRDMIREVCGF 50 Query: 238 LNMRRGLWSYLRCQK 194 R L+ K Sbjct: 51 APYERRAMELLKVSK 65 >BC091508-1|AAH91508.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 95.5 bits (227), Expect = 9e-20 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 254 EVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 93 EV G A YE+RAMELLKVSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 46 EVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 41.5 bits (93), Expect = 0.002 Identities = 27/75 (36%), Positives = 38/75 (50%) Frame = -3 Query: 418 MAPRFEIAVGLRKGLKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVRKLSDT 239 MA R+ +AVGL KG K TK + R +R +G TKH+KFVRD++R++ Sbjct: 1 MALRYPMAVGLNKGHKVTK----------NVSKPRHSRRRGRLTKHTKFVRDMIREVCGF 50 Query: 238 LNMRRGLWSYLRCQK 194 R L+ K Sbjct: 51 APYERRAMELLKVSK 65 >BC004971-1|AAH04971.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 95.5 bits (227), Expect = 9e-20 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 254 EVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 93 EV G A YE+RAMELLKVSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 46 EVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 41.5 bits (93), Expect = 0.002 Identities = 27/75 (36%), Positives = 38/75 (50%) Frame = -3 Query: 418 MAPRFEIAVGLRKGLKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVRKLSDT 239 MA R+ +AVGL KG K TK + R +R +G TKH+KFVRD++R++ Sbjct: 1 MALRYPMAVGLNKGHKVTK----------NVSKPRHSRRRGRLTKHTKFVRDMIREVCGF 50 Query: 238 LNMRRGLWSYLRCQK 194 R L+ K Sbjct: 51 APYERRAMELLKVSK 65 >BC003052-1|AAH03052.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 95.5 bits (227), Expect = 9e-20 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 254 EVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 93 EV G A YE+RAMELLKVSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 46 EVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 41.5 bits (93), Expect = 0.002 Identities = 27/75 (36%), Positives = 38/75 (50%) Frame = -3 Query: 418 MAPRFEIAVGLRKGLKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVRKLSDT 239 MA R+ +AVGL KG K TK + R +R +G TKH+KFVRD++R++ Sbjct: 1 MALRYPMAVGLNKGHKVTK----------NVSKPRHSRRRGRLTKHTKFVRDMIREVCGF 50 Query: 238 LNMRRGLWSYLRCQK 194 R L+ K Sbjct: 51 APYERRAMELLKVSK 65 >AB061833-1|BAB79471.1| 105|Homo sapiens ribosomal protein L36 protein. Length = 105 Score = 95.5 bits (227), Expect = 9e-20 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 254 EVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMRK 93 EV G A YE+RAMELLKVSKDKRALKF+K+R+GTHIRAKRKREELSNVLA MRK Sbjct: 46 EVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVLAAMRK 99 Score = 41.5 bits (93), Expect = 0.002 Identities = 27/75 (36%), Positives = 38/75 (50%) Frame = -3 Query: 418 MAPRFEIAVGLRKGLKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVRKLSDT 239 MA R+ +AVGL KG K TK + R +R +G TKH+KFVRD++R++ Sbjct: 1 MALRYPMAVGLNKGHKVTK----------NVSKPRHSRRRGRLTKHTKFVRDMIREVCGF 50 Query: 238 LNMRRGLWSYLRCQK 194 R L+ K Sbjct: 51 APYERRAMELLKVSK 65 >AB046410-1|BAB21256.1| 32|Homo sapiens ribosomal protein L36 protein. Length = 32 Score = 63.7 bits (148), Expect = 3e-10 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 209 LKVSKDKRALKFLKRRLGTHIRAKRKREELSN 114 LKVSKDKRALKF+K+R+GTHIRAKRKREELSN Sbjct: 1 LKVSKDKRALKFIKKRVGTHIRAKRKREELSN 32 >Z99496-8|CAM28259.1| 394|Homo sapiens chromosome 6 open reading frame 204 protein. Length = 394 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 329 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 376 >Z99496-4|CAM28258.1| 576|Homo sapiens chromosome 6 open reading frame 204 protein. Length = 576 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 434 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 481 >Z99496-3|CAI21606.2| 499|Homo sapiens chromosome 6 open reading frame 204 protein. Length = 499 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 434 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 481 >Z99496-2|CAM28257.1| 489|Homo sapiens chromosome 6 open reading frame 204 protein. Length = 489 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 431 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 478 >Z99496-1|CAI21605.1| 805|Homo sapiens chromosome 6 open reading frame 204 protein. Length = 805 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 431 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 478 >BC126142-1|AAI26143.1| 457|Homo sapiens C6orf204 protein protein. Length = 457 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 392 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 439 >BC126140-1|AAI26141.1| 457|Homo sapiens C6orf204 protein protein. Length = 457 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 392 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 439 >BC110835-1|AAI10836.1| 394|Homo sapiens C6orf204 protein protein. Length = 394 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 329 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 376 >BC052778-1|AAH52778.1| 392|Homo sapiens C6orf204 protein protein. Length = 392 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 329 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 376 >BC048977-1|AAH48977.1| 392|Homo sapiens C6orf204 protein protein. Length = 392 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 329 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 376 >AY313778-1|AAP81009.1| 394|Homo sapiens serologically defined breast cancer antigen NY-BR-15-like protein protein. Length = 394 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 329 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 376 >AL589993-1|CAI16048.1| 805|Homo sapiens chromosome 6 open reading frame 204 protein. Length = 805 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 431 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 478 >AL390069-4|CAM19612.1| 576|Homo sapiens chromosome 6 open reading frame 204 protein. Length = 576 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 434 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 481 >AL390069-3|CAI14135.2| 499|Homo sapiens chromosome 6 open reading frame 204 protein. Length = 499 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 434 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 481 >AL390069-2|CAM19611.1| 489|Homo sapiens chromosome 6 open reading frame 204 protein. Length = 489 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 431 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 478 >AL390069-1|CAI14134.1| 805|Homo sapiens chromosome 6 open reading frame 204 protein. Length = 805 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 431 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 478 >AF308284-1|AAG48252.1| 546|Homo sapiens serologically defined breast cancer antigen NY-BR-15 protein. Length = 546 Score = 29.9 bits (64), Expect = 5.2 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -2 Query: 263 FSTEVVGHAQYEKRAMELLKVSKDKRAL-KFLKRRLGTHIRAKRKREE 123 FS E V H+Q + +L K+ L +FLK+RL K+K EE Sbjct: 172 FSEESVSHSQQGEFEQKLASTEKEVLQLNEFLKQRLSLFSEEKKKLEE 219 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,125,876 Number of Sequences: 237096 Number of extensions: 1059450 Number of successful extensions: 2195 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2195 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4593178062 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -