BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30350 (589 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 23 2.5 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 22 3.3 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 5.8 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.7 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -2 Query: 282 SFPSYPTSAPTGLMSCGISMEKTRLFMKSPFIELLNPITCKV 157 +FP T GL G+ E T++ + S L TC++ Sbjct: 16 AFPGGRTLVEKGLRKQGVPREATKITLSSLAKGSLKQYTCEL 57 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -1 Query: 496 PRLINFSPRDNQVCRLPITNISY 428 P + + P D Q+C + I + Y Sbjct: 168 PMNLQYLPMDRQLCHIEIESFGY 190 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 71 DPSNGCNPGWPLRTFLAAL 127 +PS G PG P FL L Sbjct: 683 NPSTGSKPGKPRSAFLTDL 701 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 7.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 347 NMTGSIEVDILASLGPKLPLSFLSHPTQPAL 255 N G+ D+ SLGP SF+++ T L Sbjct: 352 NEQGNKLADLYKSLGPDSVYSFINNLTDRKL 382 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 7.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 347 NMTGSIEVDILASLGPKLPLSFLSHPTQPAL 255 N G+ D+ SLGP SF+++ T L Sbjct: 244 NEQGNKLADLYKSLGPDSVYSFINNLTDRKL 274 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,658 Number of Sequences: 336 Number of extensions: 3341 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -