BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30350 (589 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0699 - 24376987-24377154,24377259-24377406,24377530-243776... 38 0.006 09_06_0187 + 21433842-21433887,21434504-21435246,21435437-214354... 34 0.073 05_03_0369 - 13136146-13136175,13136237-13136908,13136926-131370... 31 0.90 09_06_0270 + 21954652-21955245,21955827-21955964,21956050-219562... 30 1.2 07_03_1076 + 23779941-23779988,23780102-23780191,23781580-237816... 30 1.2 02_01_0077 - 546033-546223,546314-546566,546635-546865,547165-54... 29 2.1 03_02_0665 - 10268959-10269148,10269344-10269936,10270572-102710... 29 2.7 02_05_1264 + 35321972-35322448,35323022-35323252,35323903-353245... 29 3.6 02_01_0408 - 2972240-2975380 29 3.6 12_01_0038 - 312152-312748,312930-313362,313572-314440,314535-31... 27 8.4 11_01_0039 - 290960-291086,291615-291714,291809-292013,292466-29... 27 8.4 02_05_0795 - 31792231-31794780 27 8.4 01_01_1178 + 9385261-9385374,9385457-9385620,9386251-9386453,938... 27 8.4 >01_05_0699 - 24376987-24377154,24377259-24377406,24377530-24377645, 24377743-24377925,24377998-24378186,24378273-24378497, 24378514-24378759,24378836-24378983,24379126-24379241, 24379441-24379497,24379735-24379923,24380001-24380150, 24380323-24380404,24380484-24380601,24380713-24380899, 24381044-24381138,24381223-24381277,24381376-24381567, 24381657-24381853,24382534-24382684 Length = 1003 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +1 Query: 406 LNVGVMKDTKCLLLGAGTLGCHVARNLL 489 +N+ + +CLLLGAGTLGC VAR L+ Sbjct: 634 VNLEKLSSARCLLLGAGTLGCDVARILM 661 >09_06_0187 + 21433842-21433887,21434504-21435246,21435437-21435484, 21435929-21436814,21436967-21437056,21437543-21438417 Length = 895 Score = 34.3 bits (75), Expect = 0.073 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +2 Query: 11 DVNSANCIDLDLVSTYFVF-ADPSNGCNPGWPLRTFLAALLEYRPDL 148 D S + I VST + F AD ++G +PG P R F+ L E+ PD+ Sbjct: 155 DQRSNSLIQFREVSTKYQFSADVASGSSPGLPGRVFIGRLPEWSPDV 201 >05_03_0369 - 13136146-13136175,13136237-13136908,13136926-13137016, 13137184-13137416,13137459-13137731,13137877-13138265, 13138325-13139156,13139847-13139922,13140027-13140414, 13141395-13141748,13142069-13142333,13143366-13143716 Length = 1317 Score = 30.7 bits (66), Expect = 0.90 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 475 PRDNQVCRLPITNISYLSSHLHSDQVLDAISSTLYSD 365 PR ++ L +SH+H V+DAIS +YSD Sbjct: 749 PRRRKIQELSSVQKENEASHIHMQNVMDAISRLVYSD 785 >09_06_0270 + 21954652-21955245,21955827-21955964,21956050-21956295, 21956407-21956520,21956633-21956815,21956926-21957143, 21957210-21957246,21957865-21958219,21958284-21958337, 21958513-21958529 Length = 651 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 304 PRLANMSTSMDPVILADTSSDLNIKLMKWRLV 399 PR+A++ S P+IL+D +D+ ++ W V Sbjct: 296 PRIASVLLSFPPIILSDVENDIKPRINAWEKV 327 >07_03_1076 + 23779941-23779988,23780102-23780191,23781580-23781663, 23781792-23782010,23782873-23782974,23783809-23784207, 23784332-23784561,23784749-23784842,23784931-23785113, 23785254-23785351,23785831-23786143 Length = 619 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 421 MKDTKCLLLGAGTLGCHVARNLLALGFR 504 +K K L++GAG +GC + + L GFR Sbjct: 15 VKAAKVLMVGAGGIGCELLKTLALSGFR 42 >02_01_0077 - 546033-546223,546314-546566,546635-546865,547165-547331, 547369-548008 Length = 493 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 442 LLGAGTLGCHVARNLLALGFRHKL 513 LLG GT CH NLLA F +L Sbjct: 373 LLGTGTTRCHENMNLLATSFNERL 396 >03_02_0665 - 10268959-10269148,10269344-10269936,10270572-10271004, 10271172-10272040,10272121-10272915,10273612-10273829, 10274931-10275230,10276834-10277161 Length = 1241 Score = 29.1 bits (62), Expect = 2.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 421 MKDTKCLLLGAGTLGCHVARNLLALG 498 M+D ++G+G LGC +NL +G Sbjct: 589 MRDANVFVVGSGALGCEFLKNLALMG 614 >02_05_1264 + 35321972-35322448,35323022-35323252,35323903-35324565, 35324698-35324806,35324965-35325383 Length = 632 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 71 DPSNGCNPGWPLRTF 115 DPSNG N WPLR + Sbjct: 317 DPSNGDNTNWPLRAY 331 >02_01_0408 - 2972240-2975380 Length = 1046 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +1 Query: 253 WSAGWVGWERNDKGNFGPRLANMSTSMDPVILADTSSDL 369 + GWV R D +FG L + T PV + TS +L Sbjct: 944 YGQGWVATLRGDVYSFGVVLLELLTGRRPVSILSTSEEL 982 >12_01_0038 - 312152-312748,312930-313362,313572-314440,314535-314584, 314589-315192,315674-315718,316100-316317,317020-317332, 318681-318716 Length = 1054 Score = 27.5 bits (58), Expect = 8.4 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 421 MKDTKCLLLGAGTLGCHVARNLLALG 498 ++ K ++G+G LGC +NL +G Sbjct: 464 LEQAKIFMVGSGALGCEFLKNLALMG 489 >11_01_0039 - 290960-291086,291615-291714,291809-292013,292466-292513, 295071-295646,295828-296260,296470-297338,297433-298227, 298709-298753,299135-299352,300055-300364,302715-302984 Length = 1331 Score = 27.5 bits (58), Expect = 8.4 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 421 MKDTKCLLLGAGTLGCHVARNLLALG 498 ++ K ++G+G LGC +NL +G Sbjct: 588 LEQAKIFMVGSGALGCEFLKNLALMG 613 >02_05_0795 - 31792231-31794780 Length = 849 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 439 LLLGAGTLGCHVARNLLALGFR 504 L++GAG G AR+L++LGF+ Sbjct: 274 LIVGAGFAGLAAARHLMSLGFK 295 >01_01_1178 + 9385261-9385374,9385457-9385620,9386251-9386453, 9387130-9387362,9387584-9387640,9388120-9388241, 9388366-9388425,9388426-9388543,9389005-9389286 Length = 450 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +1 Query: 400 PDLNVGVMKDTKCLLLGAGTLGCHVARNLLALGFRH 507 P L + + L++GAG LGC + ++L GF++ Sbjct: 37 PGLRDSLGSLVEVLVVGAGGLGCELLKDLALSGFKN 72 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,638,394 Number of Sequences: 37544 Number of extensions: 359594 Number of successful extensions: 849 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -