BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30350 (589 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 25 1.4 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 25 2.4 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 7.3 AY724801-1|AAW50310.1| 134|Anopheles gambiae G protein alpha su... 23 9.7 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 25.4 bits (53), Expect = 1.4 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 353 SANMTGSIEVDILASL-GPKLPLSFLSHPTQPA 258 ++ M S+ DIL L GP P+ SHP +PA Sbjct: 44 ASKMPVSVFGDILPILTGPDRPIPGRSHPAEPA 76 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 24.6 bits (51), Expect = 2.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 461 SVPAPNNKHFVSFITPTFRSGTRRHFI 381 ++P K+ + +TPTF SG RH + Sbjct: 116 ALPGQRWKNLRAKLTPTFTSGQLRHML 142 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.0 bits (47), Expect = 7.3 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = -2 Query: 333 HRGRHISEPGSKIAFIVSFPSYPTSAPTGLMSCGIS 226 + G +++ K+A I S +YP + GI+ Sbjct: 41 NNGNWVADRDGKVAIIASSETYPVQQVVSVTQSGIA 76 >AY724801-1|AAW50310.1| 134|Anopheles gambiae G protein alpha subunit AgOa protein. Length = 134 Score = 22.6 bits (46), Expect = 9.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 376 KLMKWRLVPDLNVGVMKDTKCLLLGAGTLG 465 +L++ L D + KD K LLLGAG G Sbjct: 4 RLIERNLKED-GIQAAKDIKLLLLGAGESG 32 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,590 Number of Sequences: 2352 Number of extensions: 14662 Number of successful extensions: 25 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -