BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30350 (589 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68337-10|CAA92753.1| 647|Caenorhabditis elegans Hypothetical p... 85 4e-17 AL032641-8|CAA21650.1| 647|Caenorhabditis elegans Hypothetical ... 85 4e-17 U40187-3|AAA81160.2| 430|Caenorhabditis elegans Ectopic membran... 37 0.009 Z82062-5|CAB54319.4| 582|Caenorhabditis elegans Hypothetical pr... 32 0.26 AF016685-15|AAG24139.2| 321|Caenorhabditis elegans Hypothetical... 29 2.4 AC024748-1|AAF60411.2| 218|Caenorhabditis elegans Ubiquitin con... 29 2.4 Z68882-18|CAA93101.1| 1113|Caenorhabditis elegans Hypothetical p... 29 3.2 Z81112-5|CAB03276.1| 245|Caenorhabditis elegans Hypothetical pr... 28 4.3 Z81027-4|CAB02689.1| 245|Caenorhabditis elegans Hypothetical pr... 28 4.3 U61955-9|AAC24409.3| 371|Caenorhabditis elegans Hypothetical pr... 28 4.3 U53337-6|AAA96188.2| 510|Caenorhabditis elegans Acetylcholine r... 28 4.3 AF038618-6|AAB92067.2| 402|Caenorhabditis elegans Hypothetical ... 28 4.3 Z68882-19|CAJ30225.1| 1028|Caenorhabditis elegans Hypothetical p... 27 7.5 U23139-10|AAN65328.1| 558|Caenorhabditis elegans Biotin protein... 27 9.9 U23139-9|AAN65327.1| 632|Caenorhabditis elegans Biotin protein ... 27 9.9 U23139-8|AAK31491.2| 1051|Caenorhabditis elegans Biotin protein ... 27 9.9 AY601658-1|AAS98223.1| 558|Caenorhabditis elegans biotin protei... 27 9.9 AY601657-1|AAS98222.1| 558|Caenorhabditis elegans biotin protei... 27 9.9 AY601656-1|AAS98221.1| 632|Caenorhabditis elegans biotin protei... 27 9.9 AF025463-7|AAB71007.1| 1210|Caenorhabditis elegans Hypothetical ... 27 9.9 >Z68337-10|CAA92753.1| 647|Caenorhabditis elegans Hypothetical protein M7.5 protein. Length = 647 Score = 85.0 bits (201), Expect = 4e-17 Identities = 39/80 (48%), Positives = 50/80 (62%) Frame = +1 Query: 268 VGWERNDKGNFGPRLANMSTSMDPVILADTSSDLNIKLMKWRLVPDLNVGVMKDTKCLLL 447 VGWERN P ++S DP IL + S DLN+ L+KWRL PD+ + K L+L Sbjct: 271 VGWERNANDKLQPISVDLSKEFDPKILMERSVDLNLSLIKWRLHPDIQLERYSQLKVLIL 330 Query: 448 GAGTLGCHVARNLLALGFRH 507 GAGTLGC++AR L+ G RH Sbjct: 331 GAGTLGCNIARCLIGWGVRH 350 Score = 32.3 bits (70), Expect = 0.26 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 506 INFRDNGKVSYSNPTRQVLFNYQD 577 I+F DN VSY+NP RQ L ++D Sbjct: 351 ISFLDNSTVSYNNPVRQSLSEFED 374 >AL032641-8|CAA21650.1| 647|Caenorhabditis elegans Hypothetical protein M7.5 protein. Length = 647 Score = 85.0 bits (201), Expect = 4e-17 Identities = 39/80 (48%), Positives = 50/80 (62%) Frame = +1 Query: 268 VGWERNDKGNFGPRLANMSTSMDPVILADTSSDLNIKLMKWRLVPDLNVGVMKDTKCLLL 447 VGWERN P ++S DP IL + S DLN+ L+KWRL PD+ + K L+L Sbjct: 271 VGWERNANDKLQPISVDLSKEFDPKILMERSVDLNLSLIKWRLHPDIQLERYSQLKVLIL 330 Query: 448 GAGTLGCHVARNLLALGFRH 507 GAGTLGC++AR L+ G RH Sbjct: 331 GAGTLGCNIARCLIGWGVRH 350 Score = 32.3 bits (70), Expect = 0.26 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 506 INFRDNGKVSYSNPTRQVLFNYQD 577 I+F DN VSY+NP RQ L ++D Sbjct: 351 ISFLDNSTVSYNNPVRQSLSEFED 374 >U40187-3|AAA81160.2| 430|Caenorhabditis elegans Ectopic membrane ruffles in embryoprotein 1 protein. Length = 430 Score = 37.1 bits (82), Expect = 0.009 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = +1 Query: 388 WRLVPDLNVGVMKDTKCLLLGAGTLGCHVARNLLALGFR 504 W + N +++TK L++GAG LGC + +NL GFR Sbjct: 29 WFVPGPENFEALQNTKILVIGAGGLGCELLKNLALSGFR 67 >Z82062-5|CAB54319.4| 582|Caenorhabditis elegans Hypothetical protein W02A11.4 protein. Length = 582 Score = 32.3 bits (70), Expect = 0.26 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 430 TKCLLLGAGTLGCHVARNLLALGFR 504 +K L++GAG +GC + +NL GFR Sbjct: 14 SKILVIGAGGIGCELLKNLAVTGFR 38 >AF016685-15|AAG24139.2| 321|Caenorhabditis elegans Hypothetical protein F59E11.2 protein. Length = 321 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +2 Query: 233 PQDIKPVGALVG*DGKETIKAILDPGSLICLPRWILSYWQ 352 PQ+I+ + ++G GKE + + P I LP+W++ WQ Sbjct: 281 PQNIRSIRTILGTMGKEEVAKYIPP--QIKLPKWVI--WQ 316 >AC024748-1|AAF60411.2| 218|Caenorhabditis elegans Ubiquitin conjugating enzyme protein15 protein. Length = 218 Score = 29.1 bits (62), Expect = 2.4 Identities = 21/80 (26%), Positives = 31/80 (38%), Gaps = 8/80 (10%) Frame = +1 Query: 241 HQASWSAGW------VGWERNDKGNFGPRLANMSTSMDPVILADTSSDLNIKLMKWRLV- 399 H SW+ GW +G N + T D + A S + N+K+ W L Sbjct: 108 HPESWNPGWTVSAILIGLHSFMNENSPAAGSIAGTPQDQRMYAAASKEFNVKVYNWNLAG 167 Query: 400 -PDLNVGVMKDTKCLLLGAG 456 P N + +D + LG G Sbjct: 168 NPHCNFFLTRDEEKWFLGHG 187 >Z68882-18|CAA93101.1| 1113|Caenorhabditis elegans Hypothetical protein C47E12.5a protein. Length = 1113 Score = 28.7 bits (61), Expect = 3.2 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 3/79 (3%) Frame = +1 Query: 280 RNDKGNFGPRLANMSTSMDPVILADTSSDLNIKLMKWRLVPDLNVGVM---KDTKCLLLG 450 +N +G G + M TS + + S +L K + R + L M + L+ G Sbjct: 76 KNTEGQDGEK---MDTSNNAGGVGGNSDELLDKNLYSRQIYTLGESAMVNLRTASVLISG 132 Query: 451 AGTLGCHVARNLLALGFRH 507 G++G +A+NL+ G RH Sbjct: 133 LGSVGVEIAKNLILGGVRH 151 >Z81112-5|CAB03276.1| 245|Caenorhabditis elegans Hypothetical protein AH10.2 protein. Length = 245 Score = 28.3 bits (60), Expect = 4.3 Identities = 19/52 (36%), Positives = 34/52 (65%), Gaps = 6/52 (11%) Frame = -1 Query: 502 GNPRLINFSPRDNQVCRLPIT---NISYLSS---HLHSDQVLDAISSTLYSD 365 GNPR ++F P+D+Q L I+ N+S L++ H++S++ L+ + L+SD Sbjct: 52 GNPRTLSFHPKDHQE-TLEISFSNNVSDLTTVEYHMNSNE-LNTYQTILFSD 101 >Z81027-4|CAB02689.1| 245|Caenorhabditis elegans Hypothetical protein AH10.2 protein. Length = 245 Score = 28.3 bits (60), Expect = 4.3 Identities = 19/52 (36%), Positives = 34/52 (65%), Gaps = 6/52 (11%) Frame = -1 Query: 502 GNPRLINFSPRDNQVCRLPIT---NISYLSS---HLHSDQVLDAISSTLYSD 365 GNPR ++F P+D+Q L I+ N+S L++ H++S++ L+ + L+SD Sbjct: 52 GNPRTLSFHPKDHQE-TLEISFSNNVSDLTTVEYHMNSNE-LNTYQTILFSD 101 >U61955-9|AAC24409.3| 371|Caenorhabditis elegans Hypothetical protein M03D4.6 protein. Length = 371 Score = 28.3 bits (60), Expect = 4.3 Identities = 19/66 (28%), Positives = 34/66 (51%) Frame = +2 Query: 89 NPGWPLRTFLAALLEYRPDLAKSTLQVIGLRSSMNGDFIKSLVFSIEIPQDIKPVGALVG 268 N G L +A R D+ + ++ +GL+S+ DFI ++ S+E+ + P + Sbjct: 4 NEGKDLVKMASASPFIRHDVTERLVEEVGLKSNYFNDFI-TVGESVEVDGIVLPTPRIFF 62 Query: 269 *DGKET 286 DG+ET Sbjct: 63 RDGQET 68 >U53337-6|AAA96188.2| 510|Caenorhabditis elegans Acetylcholine receptor protein 10 protein. Length = 510 Score = 28.3 bits (60), Expect = 4.3 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -1 Query: 487 INFSPRDNQVCRLPITNISYLSSHLHSDQVLDAISSTLYSDLMTYLP 347 I + P D+QVC L + +Y L + + S L DL TY P Sbjct: 96 ITYFPFDDQVCYLKFGSWTYHGLALDLSIIAEEDDSELSIDLSTYTP 142 >AF038618-6|AAB92067.2| 402|Caenorhabditis elegans Hypothetical protein F42G8.6 protein. Length = 402 Score = 28.3 bits (60), Expect = 4.3 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +1 Query: 394 LVPDLNVGVMKDTK---CLLLGAGTLGCHVARNLLALG 498 LV D V K+ K L++GAG LGC VA L A G Sbjct: 23 LVDDFGVSGQKNLKNLNVLIVGAGGLGCPVATYLGAAG 60 >Z68882-19|CAJ30225.1| 1028|Caenorhabditis elegans Hypothetical protein C47E12.5b protein. Length = 1028 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 421 MKDTKCLLLGAGTLGCHVARNLLALGFRH 507 ++ L+ G G++G +A+NL+ G RH Sbjct: 38 LRTASVLISGLGSVGVEIAKNLILGGVRH 66 >U23139-10|AAN65328.1| 558|Caenorhabditis elegans Biotin protein ligase protein 1,isoform c protein. Length = 558 Score = 27.1 bits (57), Expect = 9.9 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -3 Query: 443 NKHFVSFITPTFRSGTRRHFINFIFRSDDVS--ANMT 339 NK FV F+ + + IN FRS DVS AN T Sbjct: 123 NKEFVKFLEKNMKKLPKSTAINETFRSKDVSVGANFT 159 >U23139-9|AAN65327.1| 632|Caenorhabditis elegans Biotin protein ligase protein 1,isoform b protein. Length = 632 Score = 27.1 bits (57), Expect = 9.9 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -3 Query: 443 NKHFVSFITPTFRSGTRRHFINFIFRSDDVS--ANMT 339 NK FV F+ + + IN FRS DVS AN T Sbjct: 197 NKEFVKFLEKNMKKLPKSTAINETFRSKDVSVGANFT 233 >U23139-8|AAK31491.2| 1051|Caenorhabditis elegans Biotin protein ligase protein 1,isoform a protein. Length = 1051 Score = 27.1 bits (57), Expect = 9.9 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -3 Query: 443 NKHFVSFITPTFRSGTRRHFINFIFRSDDVS--ANMT 339 NK FV F+ + + IN FRS DVS AN T Sbjct: 616 NKEFVKFLEKNMKKLPKSTAINETFRSKDVSVGANFT 652 >AY601658-1|AAS98223.1| 558|Caenorhabditis elegans biotin protein ligase, holocarboxylasesynthetase (62.5 kD) alternative variant d protein. Length = 558 Score = 27.1 bits (57), Expect = 9.9 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -3 Query: 443 NKHFVSFITPTFRSGTRRHFINFIFRSDDVS--ANMT 339 NK FV F+ + + IN FRS DVS AN T Sbjct: 123 NKEFVKFLEKNMKKLPKSTAINETFRSKDVSVGANFT 159 >AY601657-1|AAS98222.1| 558|Caenorhabditis elegans biotin protein ligase, holocarboxylasesynthetase (62.5 kD) alternative variant c protein. Length = 558 Score = 27.1 bits (57), Expect = 9.9 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -3 Query: 443 NKHFVSFITPTFRSGTRRHFINFIFRSDDVS--ANMT 339 NK FV F+ + + IN FRS DVS AN T Sbjct: 123 NKEFVKFLEKNMKKLPKSTAINETFRSKDVSVGANFT 159 >AY601656-1|AAS98221.1| 632|Caenorhabditis elegans biotin protein ligase, holocarboxylasesynthetase (70.9 kD) alternative variant b protein. Length = 632 Score = 27.1 bits (57), Expect = 9.9 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -3 Query: 443 NKHFVSFITPTFRSGTRRHFINFIFRSDDVS--ANMT 339 NK FV F+ + + IN FRS DVS AN T Sbjct: 197 NKEFVKFLEKNMKKLPKSTAINETFRSKDVSVGANFT 233 >AF025463-7|AAB71007.1| 1210|Caenorhabditis elegans Hypothetical protein K10B4.1 protein. Length = 1210 Score = 27.1 bits (57), Expect = 9.9 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = -2 Query: 177 NPITCKVDFAK-----SGRYSNSAAKNVLSGQPGLHPLL 76 +P TC VD A S Y N A + +L G G H ++ Sbjct: 1001 DPATCVVDLASDFLNMSKIYDNEAVEQILGGMHGKHQMM 1039 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,469,678 Number of Sequences: 27780 Number of extensions: 320717 Number of successful extensions: 788 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1237082886 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -