BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30350 (589 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 22 3.9 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 22 3.9 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 22 3.9 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 5.1 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 5.1 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 21 6.8 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 9.0 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 9.0 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 9.0 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 9.0 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -1 Query: 496 PRLINFSPRDNQVCRLPITNISY 428 P + + P D Q+C + I + Y Sbjct: 139 PMNLQYFPMDRQLCHIEIESFGY 161 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -1 Query: 496 PRLINFSPRDNQVCRLPITNISY 428 P + + P D Q+C + I + Y Sbjct: 139 PMNLQYFPMDRQLCHIEIESFGY 161 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -1 Query: 496 PRLINFSPRDNQVCRLPITNISY 428 P + + P D Q+C + I + Y Sbjct: 78 PMNLQYFPMDRQLCHIEIESFGY 100 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.8 bits (44), Expect = 5.1 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -1 Query: 475 PRDNQVCRLPITNISYLSSHL 413 P D Q+C + I ++S+ + L Sbjct: 140 PHDTQICSMMIESLSHTTQDL 160 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 5.1 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = +3 Query: 429 YEMFVIGSRHTWLSRGEKFISLGFPS*TFVTTVKCHI----QIRPDKF 560 Y+ F + RH RG+ + +G F T+V+ I +R +KF Sbjct: 172 YDGFQVDLRHIDEIRGKNVVDIGVDLSEFYTSVEWDILEVPAVRNEKF 219 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 21.4 bits (43), Expect = 6.8 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -2 Query: 249 GLMSCGISMEKTRLFMKS--PFIE 184 GL+S GI + K R FM+ PF E Sbjct: 132 GLLSGGIILRKKREFMQKIWPFKE 155 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +2 Query: 227 EIPQDIKPVGALVG*DGKETIKAILDP 307 E+P D+ +V DG ET K P Sbjct: 569 EVPSDVLYNRLVVSEDGSETFKYSSQP 595 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -3 Query: 374 IFRSDDVSANMTGSIEVDILASLGP 300 ++ S++ S+ +TG+ D+L S+ P Sbjct: 102 VYVSNEPSSAITGNNVKDVLVSIDP 126 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.0 bits (42), Expect = 9.0 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = -2 Query: 132 SNSAAKNVLSGQPGLHPLLGSAKTKYVLTRSRSMQLALLTSKTS 1 +N + L G GLH L SA T + ALL+ + S Sbjct: 129 TNQTGLHGLHGLHGLHGLSSSAPTGSSCGPGAAAAAALLSKRRS 172 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +2 Query: 227 EIPQDIKPVGALVG*DGKETIKAILDP 307 E+P D+ +V DG ET K P Sbjct: 569 EVPSDVLYNRLVVSEDGSETFKYSSQP 595 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,837 Number of Sequences: 438 Number of extensions: 4296 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -