BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30349 (733 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 27 0.21 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 27 0.21 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 27 0.21 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.83 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 3.4 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 4.4 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 22 4.4 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 4.4 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 22 4.4 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 26.6 bits (56), Expect = 0.21 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 354 FELADNLVNGYRDDTRFRDFQNLEKIFGSDRDIL 455 F L +N + G R + R + QN K+FG+D L Sbjct: 78 FRLLENKL-GVRQENRVKYNQNYSKVFGNDEKAL 110 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 26.6 bits (56), Expect = 0.21 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 354 FELADNLVNGYRDDTRFRDFQNLEKIFGSDRDIL 455 F L +N + G R + R + QN K+FG+D L Sbjct: 138 FRLLENKL-GVRQENRVKYNQNYSKVFGNDEKAL 170 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 26.6 bits (56), Expect = 0.21 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 354 FELADNLVNGYRDDTRFRDFQNLEKIFGSDRDIL 455 F L +N + G R + R + QN K+FG+D L Sbjct: 138 FRLLENKL-GVRQENRVKYNQNYSKVFGNDEKAL 170 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.6 bits (51), Expect = 0.83 Identities = 11/49 (22%), Positives = 21/49 (42%) Frame = +2 Query: 461 IHYYCILHVLHNCVSILLLFSILLACGAWKANSCLVSTFFVYSFFHLFL 607 I+Y+ +H+L C I+ +L + L+ +Y F F+ Sbjct: 258 IYYFYYMHLLFCCAFIIFTMHLLFLLCIYYFYCALIILLCIYYFCRAFI 306 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 260 SCILIIMSSEILSDSKYSVLVVQKLRKVF 174 +C LIIM + S++ V QKLR F Sbjct: 250 NCTLIIMCDCVRSEASKVVKNAQKLRHKF 278 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 52 ENRIYRMRERTMSRSI 5 E R YR RER ++R I Sbjct: 560 ERRFYRHRERLVARGI 575 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 500 VSILLLFSILLACGAWKANS 559 ++ LLLF+ILLA G A S Sbjct: 290 ITTLLLFTILLAYGCAGATS 309 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 166 TKKANVFLNTISKIC 122 TK N LNT++KIC Sbjct: 492 TKGTNKQLNTLNKIC 506 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 166 TKKANVFLNTISKIC 122 TK N LNT++KIC Sbjct: 217 TKGTNKQLNTLNKIC 231 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,703 Number of Sequences: 336 Number of extensions: 3744 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -