BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30349 (733 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC14F5.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 27 2.8 SPBP4H10.10 |||rhomboid family protease|Schizosaccharomyces pomb... 27 3.6 SPCC569.05c |||spermidine family transporter |Schizosaccharomyce... 26 4.8 SPBC8D2.06 |||isoleucine-tRNA ligase |Schizosaccharomyces pombe|... 26 6.4 SPBC646.08c |||oxysterol binding protein |Schizosaccharomyces po... 25 8.4 >SPBC14F5.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 515 Score = 27.1 bits (57), Expect = 2.8 Identities = 20/52 (38%), Positives = 24/52 (46%) Frame = -2 Query: 702 NKQTMRSTSESKISPSCIQPAVKASHTISPIVRNRWKKLYTKNVLTKQELAF 547 NK+ S SE K S P HTISP + KLYT ++ K E F Sbjct: 426 NKEHSTSKSEEKSSELLKYPN---GHTISPGIIALSTKLYTGSIFPKCEKDF 474 >SPBP4H10.10 |||rhomboid family protease|Schizosaccharomyces pombe|chr 2|||Manual Length = 392 Score = 26.6 bits (56), Expect = 3.6 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 452 ISDIHYYCILHVLHNCVSILLLFSILL-ACGAWKANS 559 +S + + H+L NCV+I SI++ G WKA S Sbjct: 174 VSIFSHQNLAHLLVNCVAIYSFLSIVVYKFGVWKALS 210 >SPCC569.05c |||spermidine family transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 576 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/51 (21%), Positives = 24/51 (47%) Frame = +2 Query: 500 VSILLLFSILLACGAWKANSCLVSTFFVYSFFHLFLTIGLIVWEALTAGWI 652 + I ++S + C + ++ V + + FH+ LT+ L+ G+I Sbjct: 134 LKITCVYSYVALCSTFASSVFSVPAEAITTIFHISLTVSLLTMTVFLCGYI 184 >SPBC8D2.06 |||isoleucine-tRNA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1064 Score = 25.8 bits (54), Expect = 6.4 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = +2 Query: 143 QKYICLFCNFKILYVVSERLKQNILNHLEFQMTLLSRYKKVFVLFSTSRGKRCLRINC-- 316 +KYI + ILY ++ IL + + +Y+ +F F ++ G+R ++ Sbjct: 248 KKYILMESCLGILYKNPKKANFEILERFQGKALDGQKYEPLFPYFKSTFGERAFKLYSAD 307 Query: 317 YYNSCSGIGV 346 Y SG G+ Sbjct: 308 YVEEGSGTGI 317 >SPBC646.08c |||oxysterol binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 516 Score = 25.4 bits (53), Expect = 8.4 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -2 Query: 615 PIVRNRWKKLYTKNVLTKQELAFQAPQASKILNKSKIE 502 P+ N K YT+ KQE+ Q QAS +S E Sbjct: 442 PVTHNILAKHYTQATKAKQEIEDQQRQASAAREESHTE 479 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,980,103 Number of Sequences: 5004 Number of extensions: 60930 Number of successful extensions: 171 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 171 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -