BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30349 (733 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_1010 - 10215625-10216335,10216372-10216473 31 0.94 07_03_0497 + 18777377-18777592,18777691-18778512 29 3.8 01_07_0372 + 43134296-43134910 29 3.8 11_03_0073 - 9621199-9621312,9621401-9621476,9621553-9621619,962... 28 6.6 08_02_0661 - 19780036-19781002,19781244-19781298,19782760-19783099 28 6.6 06_01_0692 - 5047162-5047441,5047602-5047726,5048257-5048327,504... 28 6.6 04_01_0316 + 4251465-4251590,4251664-4251719,4252973-4253087,425... 28 6.6 07_03_1606 + 28111158-28111328,28111431-28111549,28111984-281120... 28 8.8 06_01_0165 + 1288107-1290476 28 8.8 >08_01_1010 - 10215625-10216335,10216372-10216473 Length = 270 Score = 31.1 bits (67), Expect = 0.94 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 459 SLICRGRNRRFFQGSGSHGTSCRPCSHSPGYLP 361 S C G +R G GS G C C+ SPGY P Sbjct: 24 SCCCCGSSRIQELGVGSGGEGCFCCASSPGYTP 56 >07_03_0497 + 18777377-18777592,18777691-18778512 Length = 345 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 604 PYNRTYCVGGFNSWLDTTRTDFALRCA 684 P N T CVG + WL RTD A A Sbjct: 5 PENSTVCVGSTDGWLALHRTDAATTAA 31 >01_07_0372 + 43134296-43134910 Length = 204 Score = 29.1 bits (62), Expect = 3.8 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = -2 Query: 729 MASIRYLTPNKQTMRSTSESKISPSCIQPAVKASHTISPI-VRNRWKKLYTKNVLTKQEL 553 MAS+ NK+ + + S S S + H P N KK TK +KQ+L Sbjct: 1 MASVVLKDLNKRLLGLSCSSAASTSIVLSGHSPPHLRDPARTSNSSKKKKTKANKSKQQL 60 Query: 552 AFQAPQASKILNKSKIE 502 A + +LN S+++ Sbjct: 61 VSPASSSRFLLNSSRMQ 77 >11_03_0073 - 9621199-9621312,9621401-9621476,9621553-9621619, 9621655-9621751,9621898-9621996,9622348-9622358, 9622716-9622784,9622871-9623195,9623287-9623457, 9623538-9623713,9624173-9624414,9624481-9624542, 9625305-9625340,9626103-9626262,9626372-9626606, 9626694-9626949,9627062-9627176,9628388-9628450, 9628592-9629325 Length = 1035 Score = 28.3 bits (60), Expect = 6.6 Identities = 18/77 (23%), Positives = 34/77 (44%) Frame = -2 Query: 702 NKQTMRSTSESKISPSCIQPAVKASHTISPIVRNRWKKLYTKNVLTKQELAFQAPQASKI 523 N ST+ IS + I+ + + K+Y K V ++ELAF+ + Sbjct: 264 NSSYNSSTTPVDISLAAIEACTDGFSESKKVGSGAYGKVY-KGVYNEEELAFKKIDGLAV 322 Query: 522 LNKSKIETQLCRTCNIQ 472 LN+ + + +L ++Q Sbjct: 323 LNEDQFKNELKHLMSVQ 339 >08_02_0661 - 19780036-19781002,19781244-19781298,19782760-19783099 Length = 453 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +2 Query: 161 FCNFKILYVVSERLKQNILNHLEFQMTLLSRYKKVFVLFSTSRG 292 +C F + RLK + + ++MTL R+++++ +T RG Sbjct: 284 YCPFMFIRDGERRLKDQVNRCMFYEMTLEQRWEEIYSCDNTHRG 327 >06_01_0692 - 5047162-5047441,5047602-5047726,5048257-5048327, 5048453-5048834,5049389-5050126 Length = 531 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -2 Query: 717 RYLTPNKQTMRSTSESKISPSCIQPAVKAS 628 R + PNK T + + ++ PSCI+P+ ++S Sbjct: 14 RSMLPNKVTALNPNAAEFVPSCIRPSFESS 43 >04_01_0316 + 4251465-4251590,4251664-4251719,4252973-4253087, 4253174-4253417,4254189-4254325,4255006-4255065, 4255336-4255460,4256021-4256048,4256267-4256336, 4256513-4256565,4256966-4257025,4257498-4257544, 4257617-4257741,4258572-4258686,4258778-4258826, 4260415-4260471,4261126-4261209,4261363-4261442, 4262005-4262094,4262252-4262375 Length = 614 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 Query: 243 YYQDTRKFLFCFPLRVGNVVF 305 YY +T KF F + LRVGNV+F Sbjct: 292 YYANTMKF-FLYRLRVGNVLF 311 >07_03_1606 + 28111158-28111328,28111431-28111549,28111984-28112024, 28112654-28112713,28112812-28112858,28112939-28113133, 28113236-28113282,28113363-28113429,28113521-28113621, 28113725-28113826,28113904-28114042,28114120-28114182, 28114323-28114406,28114981-28115295 Length = 516 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 556 FLFSEYILRV*FLPSVPYNRTYCVGGFNSW 645 F+FSE + + LP + +N +C+ F SW Sbjct: 77 FVFSEDLFFIYLLPPIIFNAGFCLLEFYSW 106 >06_01_0165 + 1288107-1290476 Length = 789 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = +2 Query: 464 HYYCILHVLHNCVSILLLFSILLAC---GAWKANSCLVSTFFVYSFFHLF 604 HY L+ V + + F ++LA W+ C++S +F+ S HL+ Sbjct: 429 HYISTPPALYTTVDLAITFLLVLANIYEEIWEFIVCILSNWFMVSLIHLY 478 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,908,575 Number of Sequences: 37544 Number of extensions: 344496 Number of successful extensions: 800 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 800 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -