BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30349 (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1751| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_26670| Best HMM Match : Tetraspannin (HMM E-Value=1.09301e-43) 33 0.18 SB_46721| Best HMM Match : Tetraspannin (HMM E-Value=4e-35) 33 0.24 SB_14775| Best HMM Match : rve (HMM E-Value=6.6e-15) 31 0.73 SB_23554| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) 29 2.9 SB_42515| Best HMM Match : TPR_2 (HMM E-Value=2e-14) 29 5.1 SB_23567| Best HMM Match : Neur_chan_LBD (HMM E-Value=0.00019) 28 9.0 SB_41644| Best HMM Match : Tetraspannin (HMM E-Value=0) 28 9.0 >SB_1751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 341 Score = 35.9 bits (79), Expect = 0.034 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 506 ILLLFSILLACGAWKANSCLVSTFFVYSFFHLFLTI 613 I+ L + L CGAWK N C++ FF + L L I Sbjct: 63 IIALVAFLGCCGAWKENKCMLICFFAFLLLLLILEI 98 >SB_26670| Best HMM Match : Tetraspannin (HMM E-Value=1.09301e-43) Length = 211 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 506 ILLLFSILLACGAWKANSCLVSTFFVYSFFHLFLTIGLIV 625 I+ + S GAWK N C++ TFFV L L I V Sbjct: 65 IIAIVSFFGCLGAWKENRCMLGTFFVLLLILLTLEIAAAV 104 >SB_46721| Best HMM Match : Tetraspannin (HMM E-Value=4e-35) Length = 642 Score = 33.1 bits (72), Expect = 0.24 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 506 ILLLFSILLACGAWKANSCLVSTFFVYSFFHLFLTIGLIV 625 I+ + + CGAWK N C++ FF+ L L I V Sbjct: 416 IITIIAFFGCCGAWKENKCMLILFFILLLIVLGLEIAAAV 455 >SB_14775| Best HMM Match : rve (HMM E-Value=6.6e-15) Length = 167 Score = 31.5 bits (68), Expect = 0.73 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 3/77 (3%) Frame = +2 Query: 137 CVQKYICLFCNFKILYVVSERLKQNILNHLEFQMTLLSRYKKVFVLFSTSRGKRCLRINC 316 C+ KYI + ++ Y + LK H+ + LSR+ V T +G C NC Sbjct: 27 CINKYILVIVDYATRYPEAVPLKSIDAEHVAEDLVKLSRF-GVPEEILTDQGSNCQGSNC 85 Query: 317 YY-NSC--SGIGVQSIR 358 SC GV+S+R Sbjct: 86 LICQSCWLRNFGVKSLR 102 >SB_23554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 503 SILLLFSILLACGAWKANSCLVSTFFVYSFFHLFLTI 613 + + L S CGA K + CL++TFF F L + I Sbjct: 334 AFIALVSFFGCCGAIKEHRCLLATFFALLFIILAVEI 370 >SB_8591| Best HMM Match : DUF601 (HMM E-Value=0.23) Length = 3368 Score = 29.5 bits (63), Expect = 2.9 Identities = 23/77 (29%), Positives = 38/77 (49%) Frame = -2 Query: 711 LTPNKQTMRSTSESKISPSCIQPAVKASHTISPIVRNRWKKLYTKNVLTKQELAFQAPQA 532 +TPN ++ + S S I P VK+S I+PIV++ L +K+ +A P Sbjct: 1041 ITPNVKSSSEITPIVKSSSEITPIVKSSSEITPIVKSSSSLLD-----SKKPVAAIVPDI 1095 Query: 531 SKILNKSKIETQLCRTC 481 S KS ++T+ +C Sbjct: 1096 STTDVKSNVDTRGHESC 1112 >SB_42515| Best HMM Match : TPR_2 (HMM E-Value=2e-14) Length = 1104 Score = 28.7 bits (61), Expect = 5.1 Identities = 23/80 (28%), Positives = 42/80 (52%) Frame = -2 Query: 726 ASIRYLTPNKQTMRSTSESKISPSCIQPAVKASHTISPIVRNRWKKLYTKNVLTKQELAF 547 AS R TP+K + +P + P+++ TI+PI + R K+ YT++ K L+F Sbjct: 595 ASKRCPTPSKAFLIGPK----APFRLYPSLRK--TIAPITKVRHKRQYTQDKSIKSRLSF 648 Query: 546 QAPQASKILNKSKIETQLCR 487 ++ IL S++E + + Sbjct: 649 YT--STVILEISRLEVDVSK 666 >SB_23567| Best HMM Match : Neur_chan_LBD (HMM E-Value=0.00019) Length = 653 Score = 27.9 bits (59), Expect = 9.0 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -2 Query: 714 YLTPNKQTMRSTSESKISPSCIQPAVKASHTISPIVRNRWKKLYTKNV 571 Y PN+ + SKI+P+ I A + I+ V + KK YT+ V Sbjct: 478 YRPPNRYPYKPLKRSKITPTVINVATSSQTNITD-VNSISKKQYTEQV 524 >SB_41644| Best HMM Match : Tetraspannin (HMM E-Value=0) Length = 252 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +2 Query: 476 ILHVLHNCVSILLLFSILLACGAWKANSCLVSTFF 580 IL ++ V++++ F L CGA K + C++ T+F Sbjct: 60 ILCIVIGIVTVIVAF--LACCGALKESQCMLGTYF 92 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,668,733 Number of Sequences: 59808 Number of extensions: 432361 Number of successful extensions: 974 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 974 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -