BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30349 (733 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT015221-1|AAT94450.1| 1216|Drosophila melanogaster RE35187p pro... 29 6.5 AY102651-1|AAM27480.1| 602|Drosophila melanogaster GH01517p pro... 29 6.5 AY069236-1|AAL39381.1| 1150|Drosophila melanogaster GH28327p pro... 29 6.5 AE014297-1927|AAF55121.3| 602|Drosophila melanogaster CG33485-P... 29 6.5 AE014296-2536|AAF49616.1| 2139|Drosophila melanogaster CG6498-PA... 29 6.5 AE013599-1707|AAM68575.1| 1360|Drosophila melanogaster CG17034-P... 29 6.5 AE013599-1706|AAM68574.1| 1360|Drosophila melanogaster CG17034-P... 29 6.5 AE013599-1705|AAF58378.2| 1235|Drosophila melanogaster CG17034-P... 29 6.5 AE013599-1704|AAM68573.1| 1150|Drosophila melanogaster CG17034-P... 29 6.5 >BT015221-1|AAT94450.1| 1216|Drosophila melanogaster RE35187p protein. Length = 1216 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 524 ILLACGAWKANSCLVSTFFVYSFFHLFLTIGLIVWEALTAGW 649 +LL GAW N +S +YSF+ + +W A+ +GW Sbjct: 955 LLLVHGAW--NYARISKLILYSFYKNVCLYVIELWFAVYSGW 994 >AY102651-1|AAM27480.1| 602|Drosophila melanogaster GH01517p protein. Length = 602 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -2 Query: 705 PNKQTMRSTSESKISPSCIQPAVKASHTISPIVRNRWK 592 P + T R+T E SP C A H ++ ++R +W+ Sbjct: 526 PLRSTRRATGERPGSPGCAPIACDMRHFLASVLRWQWR 563 >AY069236-1|AAL39381.1| 1150|Drosophila melanogaster GH28327p protein. Length = 1150 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 524 ILLACGAWKANSCLVSTFFVYSFFHLFLTIGLIVWEALTAGW 649 +LL GAW N +S +YSF+ + +W A+ +GW Sbjct: 830 LLLVHGAW--NYARISKLILYSFYKNVCLYVIELWFAVYSGW 869 >AE014297-1927|AAF55121.3| 602|Drosophila melanogaster CG33485-PA protein. Length = 602 Score = 29.1 bits (62), Expect = 6.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -2 Query: 705 PNKQTMRSTSESKISPSCIQPAVKASHTISPIVRNRWK 592 P + T R+T E SP C A H ++ ++R +W+ Sbjct: 526 PLRSTRRATGERPGSPGCAPIACDMRHFLASVLRWQWR 563 >AE014296-2536|AAF49616.1| 2139|Drosophila melanogaster CG6498-PA protein. Length = 2139 Score = 29.1 bits (62), Expect = 6.5 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -2 Query: 717 RYLTPNKQTMRSTSESKISPSCIQPAVKASHTISPIVRNRWK 592 R L+P++ RS +E+KISP C P +K T +V W+ Sbjct: 1900 RALSPDRLHPRS-AETKISPLCCSPPIK-QPTHQRVVTTTWR 1939 >AE013599-1707|AAM68575.1| 1360|Drosophila melanogaster CG17034-PC, isoform C protein. Length = 1360 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 524 ILLACGAWKANSCLVSTFFVYSFFHLFLTIGLIVWEALTAGW 649 +LL GAW N +S +YSF+ + +W A+ +GW Sbjct: 955 LLLVHGAW--NYARISKLILYSFYKNVCLYVIELWFAVYSGW 994 >AE013599-1706|AAM68574.1| 1360|Drosophila melanogaster CG17034-PB, isoform B protein. Length = 1360 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 524 ILLACGAWKANSCLVSTFFVYSFFHLFLTIGLIVWEALTAGW 649 +LL GAW N +S +YSF+ + +W A+ +GW Sbjct: 955 LLLVHGAW--NYARISKLILYSFYKNVCLYVIELWFAVYSGW 994 >AE013599-1705|AAF58378.2| 1235|Drosophila melanogaster CG17034-PA, isoform A protein. Length = 1235 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 524 ILLACGAWKANSCLVSTFFVYSFFHLFLTIGLIVWEALTAGW 649 +LL GAW N +S +YSF+ + +W A+ +GW Sbjct: 830 LLLVHGAW--NYARISKLILYSFYKNVCLYVIELWFAVYSGW 869 >AE013599-1704|AAM68573.1| 1150|Drosophila melanogaster CG17034-PD, isoform D protein. Length = 1150 Score = 29.1 bits (62), Expect = 6.5 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 524 ILLACGAWKANSCLVSTFFVYSFFHLFLTIGLIVWEALTAGW 649 +LL GAW N +S +YSF+ + +W A+ +GW Sbjct: 830 LLLVHGAW--NYARISKLILYSFYKNVCLYVIELWFAVYSGW 869 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,459,692 Number of Sequences: 53049 Number of extensions: 606262 Number of successful extensions: 1616 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1616 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3293648160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -