BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30348 (625 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 4.8 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 4.8 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.4 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 8.4 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.4 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.4 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 4.8 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -2 Query: 300 KGQYLMPNIGYGSNKRPVICSQMDSVRS*FTMLKSWKS 187 KGQ+ PN G+ +N + + R F M+ S+ S Sbjct: 317 KGQFRDPNTGFMTNTPLEVFTITPGRRYRFRMINSFAS 354 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 4.8 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -2 Query: 300 KGQYLMPNIGYGSNKRPVICSQMDSVRS*FTMLKSWKS 187 KGQ+ PN G+ +N + + R F M+ S+ S Sbjct: 317 KGQFRDPNTGFMTNTPLEVFTITPGRRYRFRMINSFAS 354 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 369 RYDKLKRNWRKPRGIDNR 316 +++ L +W PRG D+R Sbjct: 631 QFNGLDVDWEYPRGADDR 648 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.0 bits (42), Expect = 8.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 283 HQVLTLESPADSVVNTSRFTPI 348 HQ+LTL DS++ R+ + Sbjct: 129 HQILTLLMDIDSLITKWRYNHV 150 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 8.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 283 HQVLTLESPADSVVNTSRFTPI 348 HQ+LTL DS++ R+ + Sbjct: 289 HQILTLLMDIDSLITKWRYNHV 310 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 8.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 283 HQVLTLESPADSVVNTSRFTPI 348 HQ+LTL DS++ R+ + Sbjct: 289 HQILTLLMDIDSLITKWRYNHV 310 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,453 Number of Sequences: 336 Number of extensions: 2672 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -