BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30348 (625 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 136 1e-34 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 5.6 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 5.6 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 5.6 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 7.4 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 9.8 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 9.8 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 9.8 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 136 bits (330), Expect = 1e-34 Identities = 60/64 (93%), Positives = 63/64 (98%) Frame = -2 Query: 444 MAIRPVYRPTIVKKRTKRFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYG 265 MAIRPVYRPTIVKKRTK+FIRHQSDRY KLKRNWRKP+GIDNRVRRRFKGQYLMPNIGYG Sbjct: 1 MAIRPVYRPTIVKKRTKKFIRHQSDRYSKLKRNWRKPKGIDNRVRRRFKGQYLMPNIGYG 60 Query: 264 SNKR 253 SNK+ Sbjct: 61 SNKK 64 Score = 130 bits (315), Expect = 8e-33 Identities = 63/72 (87%), Positives = 68/72 (94%) Frame = -1 Query: 259 QETRHMLPNGFRKVLVHNVKELEILMMQNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVT 80 ++TRHMLP GFRKVLVHNVKELE+LMMQNRK+CAEIAHG SSKKRK IVERAQQLSIRVT Sbjct: 63 KKTRHMLPTGFRKVLVHNVKELEVLMMQNRKFCAEIAHGGSSKKRKSIVERAQQLSIRVT 122 Query: 79 NAAARLRSQENE 44 A+ARLRSQENE Sbjct: 123 YASARLRSQENE 134 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.6 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 23 LIIQLYLFVLLGPEASGRI 79 L + +LFV+ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.6 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 23 LIIQLYLFVLLGPEASGRI 79 L + +LFV+ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.6 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 23 LIIQLYLFVLLGPEASGRI 79 L + +LFV+ ++SGRI Sbjct: 15 LFVNSFLFVIAAQDSSGRI 33 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -3 Query: 530 PPRVFFFFPSRAAVSPRGSLSRFLKKHTRW 441 PP V P R +PR + ++ + H R+ Sbjct: 130 PPSVSLSSPPREPGTPRINFTKLKRHHPRY 159 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.0 bits (42), Expect = 9.8 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 56 GPEASGRIRHSDA 94 GP GR +H+DA Sbjct: 45 GPNELGRFKHTDA 57 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.0 bits (42), Expect = 9.8 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 56 GPEASGRIRHSDA 94 GP GR +H+DA Sbjct: 50 GPNELGRFKHTDA 62 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.0 bits (42), Expect = 9.8 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 56 GPEASGRIRHSDA 94 GP GR +H+DA Sbjct: 50 GPNELGRFKHTDA 62 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,204 Number of Sequences: 438 Number of extensions: 3257 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -