BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30347 (344 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0930 - 9173245-9173305,9173438-9173504,9173856-9174042 59 1e-09 02_04_0349 + 22222091-22222639,22222718-22223695 27 5.2 04_01_0024 + 344621-344830,344926-345705 26 9.1 >08_01_0930 - 9173245-9173305,9173438-9173504,9173856-9174042 Length = 104 Score = 58.8 bits (136), Expect = 1e-09 Identities = 22/48 (45%), Positives = 35/48 (72%) Frame = +1 Query: 70 WRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRVTPWANGR 213 WR AG+TYI YSN+ A ++RR LK+ ++EA R++ H ++ WA+G+ Sbjct: 11 WRAAGMTYIGYSNVCAALVRRCLKEPHKSEAASREKVHFAISKWADGK 58 >02_04_0349 + 22222091-22222639,22222718-22223695 Length = 508 Score = 26.6 bits (56), Expect = 5.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 244 TLEQLSGGVQVVRWP 200 TLE LSGGV ++ WP Sbjct: 406 TLESLSGGVPMLSWP 420 >04_01_0024 + 344621-344830,344926-345705 Length = 329 Score = 25.8 bits (54), Expect = 9.1 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 109 IAAKVLRRSLKQEFRAEALKRDESHVRV-TPW 201 + V RR +KQE RAEA K + V PW Sbjct: 273 VTVLVERRMVKQEHRAEAYKLYQKRTSVWIPW 304 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,082,132 Number of Sequences: 37544 Number of extensions: 141671 Number of successful extensions: 372 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 372 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 494158076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -