BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30347 (344 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13256| Best HMM Match : rve (HMM E-Value=1.1e-17) 29 1.3 SB_39756| Best HMM Match : Ribosomal_S25 (HMM E-Value=2.6) 28 2.3 SB_36906| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_11375| Best HMM Match : EGF_CA (HMM E-Value=0) 28 2.3 SB_24526| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_55915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_34416| Best HMM Match : Peptidase_C1 (HMM E-Value=2e-09) 27 4.1 SB_28811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_33594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_23494| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_39666| Best HMM Match : Fe-ADH (HMM E-Value=0.59) 27 5.4 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.1 SB_1962| Best HMM Match : Leu_leader (HMM E-Value=5.2) 26 7.1 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.4 SB_3667| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.4 SB_35882| Best HMM Match : Neur_chan_memb (HMM E-Value=8.8e-26) 26 9.4 SB_7484| Best HMM Match : Neur_chan_memb (HMM E-Value=1.3e-10) 26 9.4 >SB_13256| Best HMM Match : rve (HMM E-Value=1.1e-17) Length = 321 Score = 28.7 bits (61), Expect = 1.3 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -3 Query: 228 LEVCRSSVGPRCDSDVRFVTFQRLCSK 148 L C SSV PR D+D R +TF+ C K Sbjct: 291 LNHCTSSVPPRFDND-RQITFKEACKK 316 >SB_39756| Best HMM Match : Ribosomal_S25 (HMM E-Value=2.6) Length = 190 Score = 27.9 bits (59), Expect = 2.3 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 Query: 228 LEVCRSSVGPRCDSDVRFVTFQRLCSK 148 L C SSV PR D+D R +TF C K Sbjct: 160 LNHCTSSVPPRFDND-RQITFTEACKK 185 >SB_36906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 27.9 bits (59), Expect = 2.3 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 Query: 228 LEVCRSSVGPRCDSDVRFVTFQRLCSK 148 L C SSV PR D+D R +TF C K Sbjct: 507 LNHCTSSVPPRFDND-RQITFTEACKK 532 >SB_11375| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 651 Score = 27.9 bits (59), Expect = 2.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 198 LGQRTTCTPPESCSKVKKES*PTCMKIINY*FM*NCTINN 317 L TTC + C ++KK S + +N+ NCT N+ Sbjct: 175 LSDNTTCRDIDECEELKKTSLSCGQRCLNFPGGYNCTCNS 214 >SB_24526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 27.5 bits (58), Expect = 3.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 148 FRAEALKRDESHVRVTPWANGRPAH 222 FR L +S VR +PWA RPA+ Sbjct: 105 FRGPPLFAPKSRVRASPWACTRPAY 129 >SB_55915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 27.1 bits (57), Expect = 4.1 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 228 LEVCRSSVGPRCDSDVRFVTFQRLCS 151 L C SSV PR D+D R +TF+ C+ Sbjct: 225 LNHCTSSVPPRFDND-RQITFKEACA 249 >SB_34416| Best HMM Match : Peptidase_C1 (HMM E-Value=2e-09) Length = 817 Score = 27.1 bits (57), Expect = 4.1 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -3 Query: 261 VNFPSSLWNSFLEVCRSSVGPRCDSDVRFVTFQRLC 154 VN SL LE+ + P CDSD+ + Q LC Sbjct: 560 VNVVESLAGKVLELPPQGI-PSCDSDIYSIALQLLC 594 >SB_28811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 982 Score = 27.1 bits (57), Expect = 4.1 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +3 Query: 57 QNERLEASWFNLHKLLKHRSQGASQVTKARISSRGVET*RISRQSHTLGQRTTCTP 224 +NER+ A+W +++ LK ++ + T R++ R SR S +G + T P Sbjct: 152 RNERISATWMCVYRSLKQFAKVFGEETGGRMTIRSA-----SRHSIKVGPQETLIP 202 >SB_33594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 26.6 bits (56), Expect = 5.4 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 261 VNFPSSLWNSFLEVCRSSVGPRCDSDVRFVTFQRL 157 V +P +W S + + + G R + RF+T QR+ Sbjct: 473 VRYPKVIWRSTTAIWKENAGVRNLTHFRFLTEQRI 507 >SB_23494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1013 Score = 26.6 bits (56), Expect = 5.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 148 FRAEALKRDESHVRVTPWANGRPAH 222 F A L +S VR +PWA RPA+ Sbjct: 832 FAAPPLFAPKSRVRASPWACTRPAY 856 >SB_39666| Best HMM Match : Fe-ADH (HMM E-Value=0.59) Length = 483 Score = 26.6 bits (56), Expect = 5.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 148 FRAEALKRDESHVRVTPWANGRPAH 222 F A L +S VR +PWA RPA+ Sbjct: 353 FAAPPLFAPKSRVRASPWACTRPAY 377 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 26.2 bits (55), Expect = 7.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 192 HTLGQRTTCTPPESCSKVKKE 254 H GQ TPP+SCS + ++ Sbjct: 1227 HNYGQPPPMTPPDSCSPIPED 1247 >SB_1962| Best HMM Match : Leu_leader (HMM E-Value=5.2) Length = 140 Score = 26.2 bits (55), Expect = 7.1 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 37 KVNKNINKMSAWRQAGLTYINYSNIAAKVLRRS 135 ++N ++NKMS+W +N S A +L S Sbjct: 32 ELNSSLNKMSSWSSTSHLLLNASKTKAMLLSTS 64 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 25.8 bits (54), Expect = 9.4 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -3 Query: 219 CRSSVGPRCD-SDVRFVTFQRLCSK 148 C+ V PRCD S VR + Q+ SK Sbjct: 3229 CQPEVAPRCDTSQVRLASTQQCVSK 3253 >SB_3667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 25.8 bits (54), Expect = 9.4 Identities = 11/53 (20%), Positives = 25/53 (47%) Frame = +1 Query: 25 FLRIKVNKNINKMSAWRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESH 183 F+ + + + + R +TY N+S+ A+ + + Q+ R E ++ H Sbjct: 333 FIANRAHLTSRRAHSSRAKSVTYANFSSTEARRAKTTSSQDIRTEQIQASRYH 385 >SB_35882| Best HMM Match : Neur_chan_memb (HMM E-Value=8.8e-26) Length = 360 Score = 25.8 bits (54), Expect = 9.4 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -3 Query: 81 SLPPSAHFVNVLIYFYSQK*IEIFL 7 S+PP++ V ++ FYS IE+FL Sbjct: 145 SIPPTSEAVPLIGIFYSASMIEVFL 169 >SB_7484| Best HMM Match : Neur_chan_memb (HMM E-Value=1.3e-10) Length = 384 Score = 25.8 bits (54), Expect = 9.4 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -3 Query: 81 SLPPSAHFVNVLIYFYSQK*IEIFL 7 S+PP++ V ++ FYS IE+FL Sbjct: 209 SIPPTSEAVPLIGIFYSASMIEVFL 233 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,431,131 Number of Sequences: 59808 Number of extensions: 165832 Number of successful extensions: 453 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 510674393 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -