BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30347 (344 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 25 1.0 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 22 5.6 AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. 22 5.6 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 22 7.4 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 22 7.4 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 21 9.7 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +1 Query: 151 RAEALKRDESHVRVTPWANGRPAHLQKAVPK*RR 252 R+ +R R T W RP K +P+ RR Sbjct: 272 RSPPARRRSRSTRPTSWPRSRPTSKPKRLPRRRR 305 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 3/25 (12%) Frame = +1 Query: 49 NINKMSAWRQAGLTYI---NYSNIA 114 N+N ++ + Q GL+Y+ N SNI+ Sbjct: 3087 NLNTITCYEQHGLSYVFPHNTSNIS 3111 >AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. Length = 167 Score = 22.2 bits (45), Expect = 5.6 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -1 Query: 233 AFWRCAGRPLAQGVTLT*DSSRFNASARNSCFSDLRSTLAAM 108 A+W AG+P+ QG + DS A+ N + R+ M Sbjct: 71 AYWADAGKPVQQGDSP--DSQNAYANCANEPYCAARTVQGYM 110 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 21.8 bits (44), Expect = 7.4 Identities = 10/24 (41%), Positives = 16/24 (66%), Gaps = 3/24 (12%) Frame = +1 Query: 49 NINKMSAWRQAGLTYI---NYSNI 111 N+N ++ + Q GL+Y+ N SNI Sbjct: 3084 NLNTITCYEQHGLSYVFPHNTSNI 3107 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 201 GQRTTCTPPESCSKVKK 251 G TC P ++CS V+K Sbjct: 36 GTAGTCEPVKNCSYVRK 52 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 21.4 bits (43), Expect = 9.7 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -3 Query: 270 CMLVNFPSSLWNSFLEVCRSSV 205 C + N+ S W ++ VC +V Sbjct: 195 CAMQNWVSGTWQTYYFVCNYAV 216 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 317,259 Number of Sequences: 2352 Number of extensions: 5388 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24505155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -