BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30347 (344 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016427-2|AAB65352.1| 54|Caenorhabditis elegans Hypothetical ... 55 1e-08 L23647-8|AAK29993.1| 54|Caenorhabditis elegans Hypothetical pr... 46 1e-05 L07144-2|AAK21439.1| 54|Caenorhabditis elegans Hypothetical pr... 46 1e-05 U80448-8|AAB37821.3| 1014|Caenorhabditis elegans Hypothetical pr... 26 6.3 >AF016427-2|AAB65352.1| 54|Caenorhabditis elegans Hypothetical protein F32D1.2 protein. Length = 54 Score = 55.2 bits (127), Expect = 1e-08 Identities = 23/51 (45%), Positives = 34/51 (66%) Frame = +1 Query: 61 MSAWRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRVTPWANGR 213 M AWR AGL Y+ YS IAA++ R+ KQ A+K+ E+ +++T W NG+ Sbjct: 1 MVAWRAAGLNYVRYSQIAAEITRKCTKQVGGKAAVKKPEATLKITTWENGK 51 >L23647-8|AAK29993.1| 54|Caenorhabditis elegans Hypothetical protein ZC262.5 protein. Length = 54 Score = 45.6 bits (103), Expect = 1e-05 Identities = 21/51 (41%), Positives = 32/51 (62%) Frame = +1 Query: 61 MSAWRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRVTPWANGR 213 M AWR AGL Y+ YS IAA+V+R+ K +K+ ++ ++ T W NG+ Sbjct: 1 MVAWRAAGLNYVRYSQIAAQVVRQCTK---GGANVKKPQATLKTTAWENGK 48 >L07144-2|AAK21439.1| 54|Caenorhabditis elegans Hypothetical protein R05D3.6 protein. Length = 54 Score = 45.6 bits (103), Expect = 1e-05 Identities = 21/51 (41%), Positives = 32/51 (62%) Frame = +1 Query: 61 MSAWRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRVTPWANGR 213 M AWR AGL Y+ YS IAA+V+R+ K +K+ ++ ++ T W NG+ Sbjct: 1 MVAWRAAGLNYVRYSQIAAQVVRQCTK---GGANVKKPQATLKTTAWENGK 48 >U80448-8|AAB37821.3| 1014|Caenorhabditis elegans Hypothetical protein F59A3.1 protein. Length = 1014 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 43 NKNINKMSAWRQAGLTYINYSNI 111 N N N+M+AW +A T +NY NI Sbjct: 78 NHNYNEMTAWLKA--TRLNYPNI 98 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,135,444 Number of Sequences: 27780 Number of extensions: 131497 Number of successful extensions: 345 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 12,740,198 effective HSP length: 72 effective length of database: 10,740,038 effective search space used: 451081596 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -