BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30346 (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.16 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 1.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 27.1 bits (57), Expect = 0.16 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 698 KLLEPRPYHIISVSRFASVQNTVPRFFNCSWMK 600 K+ P+PY S + FA+ R+ +C W K Sbjct: 1269 KMGGPQPYSACSENAFAAYPGDCTRYLHCLWGK 1301 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 23.4 bits (48), Expect = 1.9 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +2 Query: 392 VTIYESLVTVEYLDEVY 442 + +Y SL+ + Y+DEV+ Sbjct: 219 IILYSSLMVLNYIDEVF 235 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,931 Number of Sequences: 336 Number of extensions: 3586 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -