BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30346 (728 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC215.03c |csn1||COP9/signalosome complex subunit Csn1|Schizos... 28 1.2 SPBC19C2.10 |||BAR adaptor protein|Schizosaccharomyces pombe|chr... 27 2.7 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 27 2.7 SPAC31G5.10 |eta2||Myb family transcriptional regulator Eta2|Sch... 26 6.3 SPAC21E11.06 |tif224||translation initiation factor eIF2B delta ... 25 8.4 >SPBC215.03c |csn1||COP9/signalosome complex subunit Csn1|Schizosaccharomyces pombe|chr 2|||Manual Length = 422 Score = 28.3 bits (60), Expect = 1.2 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +3 Query: 90 VLEYVLPYTGVPFRNMSAIKDSRNINFNTKHLRKGDPLPPFNGKLRVYNMR-YCPYLSEP 266 +L+Y++PY+ +PF + A+ + NF K+L + NGK+ R Y SEP Sbjct: 312 LLDYLIPYSALPFSKI-AVDFHIDENFIEKNLLEIIEAKKLNGKVDSLQKRVYIEPSSEP 370 >SPBC19C2.10 |||BAR adaptor protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 501 Score = 27.1 bits (57), Expect = 2.7 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 517 IQSLFIKILKFSDTVNEEHVAAYHKALDFIQEQLKNRGTVF 639 +Q F+ L S N E+ A KALD +++++NR VF Sbjct: 110 LQEEFMDYLNNSFLANLENSLAEFKALDVKEKKMENRRLVF 150 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 27.1 bits (57), Expect = 2.7 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = +2 Query: 236 HEVLPLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAF 358 + +LP+ +R I + ++N D + P W + +S F Sbjct: 341 YRLLPVEERNISCSGRDDFAWGILNDDWVSHPTWASEESGF 381 >SPAC31G5.10 |eta2||Myb family transcriptional regulator Eta2|Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 25.8 bits (54), Expect = 6.3 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -3 Query: 684 KAISYNQRIQVRFRPEHSASVFQLFLDEI*SLVVRSNMLLIDSVREF 544 ++IS Q I++ EH+ S Q FL+ + S + R L+ +R F Sbjct: 182 RSISREQMIEI-LEDEHAGSRLQGFLESVASFLNRKENSLLKYMRAF 227 >SPAC21E11.06 |tif224||translation initiation factor eIF2B delta subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 467 Score = 25.4 bits (53), Expect = 8.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 38 GHAPNIFVVSRCSSYQSSIRIRL 106 GH N+ V++ C SY+ + RI+L Sbjct: 365 GHESNVPVIACCESYKFTERIQL 387 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,917,616 Number of Sequences: 5004 Number of extensions: 59171 Number of successful extensions: 114 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -