BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30346 (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8108| Best HMM Match : GST_N (HMM E-Value=3.9e-14) 71 7e-13 SB_3922| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48592| Best HMM Match : Galactosyl_T (HMM E-Value=1.5e-26) 47 2e-05 SB_16773| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_11755| Best HMM Match : GST_C (HMM E-Value=2.7e-05) 31 0.96 SB_46097| Best HMM Match : zf-CCHC (HMM E-Value=7.2e-05) 29 2.9 SB_13167| Best HMM Match : APH (HMM E-Value=1e-04) 29 3.9 SB_37619| Best HMM Match : CUB (HMM E-Value=1.9e-37) 29 3.9 SB_26637| Best HMM Match : zf-CCHC (HMM E-Value=0.018) 29 3.9 SB_14676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_38757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_8108| Best HMM Match : GST_N (HMM E-Value=3.9e-14) Length = 238 Score = 71.3 bits (167), Expect = 7e-13 Identities = 33/87 (37%), Positives = 54/87 (62%), Gaps = 1/87 (1%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDKPEW-LTTKSAFAKVPAIEIAEDVTIYESLVTVE 424 P +R L L AK +DYE +NI+L +KP+W L + VP IE+ + + ESL+ E Sbjct: 28 PYAERPRLVLAAKGVDYECININLKNKPDWYLAEPNPRGLVPMIEMPDGRLLPESLLCCE 87 Query: 425 YLDEVYPKRPLLPQDPLKKALDKIIVE 505 YLDE++P+ P+ P D +K +++++ Sbjct: 88 YLDELFPQNPMYPSDAFEKNRQRLLID 114 Score = 45.2 bits (102), Expect = 5e-05 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +3 Query: 180 HLRKGDPLPPFNGKLRVYNMRYCPYLSEP 266 HL GDP PP KLR+Y+MR+CPY P Sbjct: 5 HLSNGDPRPPPGDKLRLYSMRFCPYAERP 33 Score = 32.7 bits (71), Expect = 0.31 Identities = 10/17 (58%), Positives = 15/17 (88%) Frame = +3 Query: 645 GSEPGYADYMIWPWFEK 695 G +PG AD+M+WP+FE+ Sbjct: 162 GEKPGMADFMLWPFFER 178 >SB_3922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 70.9 bits (166), Expect = 1e-12 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 1/87 (1%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTK-SAFAKVPAIEIAEDVTIYESLVTVE 424 P +R L L AK +DYE VN++L KPEW T KVP +E + I ES++ E Sbjct: 39 PFAERPRLVLAAKGLDYECVNVNLKSKPEWFQTHPDCEGKVPTLETMDGKLIPESVIICE 98 Query: 425 YLDEVYPKRPLLPQDPLKKALDKIIVE 505 +L++ Y K PL P DP K+ K++ + Sbjct: 99 FLEDYYRKIPLYPCDPYAKSRQKLLAQ 125 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +3 Query: 159 NINFNTKHLRKGD--PLPPFNGKLRVYNMRYCPYLSEP 266 +I H+ KG P P N KLR+Y+MR+CP+ P Sbjct: 8 SITMPVTHISKGSSRPAKPQN-KLRLYSMRFCPFAERP 44 >SB_48592| Best HMM Match : Galactosyl_T (HMM E-Value=1.5e-26) Length = 492 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 2/81 (2%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDK-PEWLTTKSAFAKVPAIEIAEDVTIYESLVTVE 424 P QR +A+ AK+ ++E + + +K PEWL VP I + +YES + +E Sbjct: 271 PFAQRAWIAMLAKKAEFEYIEQNPYNKTPEWLAINPN-GLVPVI-VHNGNAVYESSICIE 328 Query: 425 YLDEVYPKR-PLLPQDPLKKA 484 ++DE + +LP+DP K+A Sbjct: 329 FIDEAFSTPVTILPKDPYKRA 349 >SB_16773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1644 Score = 32.3 bits (70), Expect = 0.41 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 505 STAPIQSLFIKILKFSDTVNEEHVAAYHKALDFIQEQLKNRGTVFWTEANL 657 S +P S +K L F +TVN EH + K + + ++ G W + L Sbjct: 591 SLSPDDSYSLKTLPFHETVNGEHTSIAEKKVYVLPSEIPKAGLNIWERSGL 641 >SB_11755| Best HMM Match : GST_C (HMM E-Value=2.7e-05) Length = 142 Score = 31.1 bits (67), Expect = 0.96 Identities = 15/24 (62%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = +2 Query: 419 VEYLDEVYPKRPLLPQ-DPLKKAL 487 +EYLDE P PLLP+ DP K+AL Sbjct: 1 MEYLDETRPDPPLLPRGDPHKRAL 24 >SB_46097| Best HMM Match : zf-CCHC (HMM E-Value=7.2e-05) Length = 430 Score = 29.5 bits (63), Expect = 2.9 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +3 Query: 84 SQVLEYVLPYTGVPFRNMSAIKDSRNINFNTKHLRKGDPLPPFNGKLRVYNMRYCP 251 +Q +++ LP TG+ ++ S I D ++ +R+ DPL F G ++ CP Sbjct: 66 AQKMKFSLP-TGIVEQSASNIHDIKSSKSQNDKMRQDDPLCKFCGLRHSFSQGKCP 120 >SB_13167| Best HMM Match : APH (HMM E-Value=1e-04) Length = 374 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +1 Query: 532 IKILKFSDTVNEEHVAAYHKALDFIQEQ 615 +KIL SD+ NEE + A + A+D+++E+ Sbjct: 60 LKILNSSDSSNEELIYAENAAIDYLRER 87 >SB_37619| Best HMM Match : CUB (HMM E-Value=1.9e-37) Length = 149 Score = 29.1 bits (62), Expect = 3.9 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -2 Query: 721 LSSWANALSFSNQGHII*SAYPGSLPSRTQCLGFSTVPG*NLK 593 LS QG + YPG P+RT+C+ P N K Sbjct: 12 LSEACGGRQSGQQGVVFSPGYPGQYPTRTRCVWVLVAPSANQK 54 >SB_26637| Best HMM Match : zf-CCHC (HMM E-Value=0.018) Length = 406 Score = 29.1 bits (62), Expect = 3.9 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = +3 Query: 159 NINFNTKHLRKGDPLPPFNGKLRVYNMRYC---PYLSEP 266 NI NT HLR PLP + +L++ MRY PY++ P Sbjct: 330 NIRRNTIHLRPAAPLPT-DDRLQMMVMRYPASEPYIANP 367 >SB_14676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 905 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +3 Query: 84 SQVLEYVLPYTGVPFRNMSAIKDSRNINFNTKHLRKGDPLPPFNGKLRVYNMRYCP 251 +Q +++ LP TG+ ++ S I D ++ +R+ DPL F G ++ CP Sbjct: 176 TQKMKFSLP-TGIVEQSASNIYDIKSSKSQNNKVRQDDPLCKFCGLKHSFSKGKCP 230 >SB_38757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +1 Query: 571 HVAAYHKALDFIQEQLKNRGTVFWTEANLDT 663 HVAA H +D + LKN+G V T A+L T Sbjct: 56 HVAAAHDHVDCAEFLLKNKGNVNQTIADLIT 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,565,880 Number of Sequences: 59808 Number of extensions: 424376 Number of successful extensions: 930 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -