BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30346 (728 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29440.1 68415.m03577 glutathione S-transferase, putative 58 8e-09 At2g29460.1 68415.m03579 glutathione S-transferase, putative 56 2e-08 At2g29450.1 68415.m03578 glutathione S-transferase (103-1A) iden... 56 2e-08 At2g29490.1 68415.m03582 glutathione S-transferase, putative sim... 54 1e-07 At2g29420.1 68415.m03575 glutathione S-transferase, putative 54 1e-07 At1g19570.1 68414.m02437 dehydroascorbate reductase, putative si... 54 1e-07 At1g78320.1 68414.m09127 glutathione S-transferase, putative sim... 52 4e-07 At1g17180.1 68414.m02094 glutathione S-transferase, putative Sec... 52 4e-07 At2g29480.1 68415.m03581 glutathione S-transferase, putative sim... 51 7e-07 At1g17170.1 68414.m02093 glutathione S-transferase, putative One... 50 2e-06 At5g16710.1 68418.m01956 dehydroascorbate reductase, putative St... 50 2e-06 At2g02390.2 68415.m00177 glutathione S-transferase zeta 1 (GSTZ1... 49 3e-06 At2g02390.1 68415.m00178 glutathione S-transferase zeta 1 (GSTZ1... 49 3e-06 At2g02380.1 68415.m00176 glutathione S-transferase, putative sim... 48 5e-06 At1g53680.1 68414.m06108 glutathione S-transferase, putative sim... 48 5e-06 At5g62480.1 68418.m07841 glutathione S-transferase, putative 48 8e-06 At2g29470.1 68415.m03580 glutathione S-transferase, putative sim... 47 1e-05 At1g78380.1 68414.m09134 glutathione S-transferase, putative sim... 47 1e-05 At1g75270.1 68414.m08744 dehydroascorbate reductase, putative si... 46 2e-05 At1g78340.1 68414.m09129 glutathione S-transferase, putative sim... 46 3e-05 At5g36270.1 68418.m04375 dehydroascorbate reductase, putative si... 44 8e-05 At1g74590.1 68414.m08640 glutathione S-transferase, putative sim... 44 1e-04 At2g02390.3 68415.m00179 glutathione S-transferase zeta 1 (GSTZ1... 44 1e-04 At5g02780.1 68418.m00220 In2-1 protein, putative similar to In2-... 43 2e-04 At1g17190.1 68414.m02095 glutathione S-transferase, putative One... 43 2e-04 At3g09270.1 68416.m01101 glutathione S-transferase, putative sim... 43 2e-04 At1g27140.1 68414.m03307 glutathione S-transferase, putative sim... 42 3e-04 At1g27130.1 68414.m03306 glutathione S-transferase, putative sim... 42 4e-04 At1g78360.1 68414.m09132 glutathione S-transferase, putative sim... 42 6e-04 At1g78370.1 68414.m09133 glutathione S-transferase, putative sim... 41 7e-04 At3g55040.1 68416.m06112 In2-1 protein, putative similar to In2-... 40 0.002 At1g59700.1 68414.m06716 glutathione S-transferase, putative sim... 40 0.002 At5g02790.1 68418.m00221 In2-1 protein, putative similar to In2-... 40 0.002 At1g69920.1 68414.m08046 glutathione S-transferase, putative sim... 38 0.005 At3g43800.1 68416.m04681 glutathione S-transferase, putative glu... 38 0.007 At5g17220.1 68418.m02018 glutathione S-transferase, putative 38 0.009 At2g47730.1 68415.m05960 glutathione S-transferase 6 (GST6) iden... 37 0.016 At3g03190.1 68416.m00315 glutathione S-transferase, putative ide... 35 0.048 At2g30860.1 68415.m03761 glutathione S-transferase, putative ide... 33 0.19 At5g40000.1 68418.m04851 AAA-type ATPase family protein BCS1 nuc... 31 0.78 At1g71210.1 68414.m08217 pentatricopeptide (PPR) repeat-containi... 31 1.0 At5g42150.1 68418.m05131 expressed protein 30 1.8 At5g41860.1 68418.m05097 expressed protein 29 4.2 At3g28610.1 68416.m03571 AAA-type ATPase family protein contains... 28 5.5 At3g28600.1 68416.m03570 AAA-type ATPase family protein contains... 28 5.5 At3g06500.1 68416.m00754 beta-fructofuranosidase, putative / inv... 28 7.3 At2g37780.1 68415.m04639 DC1 domain-containing protein contains ... 27 9.6 >At2g29440.1 68415.m03577 glutathione S-transferase, putative Length = 223 Score = 57.6 bits (133), Expect = 8e-09 Identities = 33/115 (28%), Positives = 53/115 (46%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEY 427 P +R +AL K + YE + DL +K L S K + + TI ES V +EY Sbjct: 16 PFSRRIEMALKLKGVPYEYLEEDLENKSSLLLALSPIHKKIPVLVHNGKTIIESHVILEY 75 Query: 428 LDEVYPKRPLLPQDPLKKALDKIIVEAXXXXXXXXXXXXXXXTLSMRSMLLRTTR 592 +DE + P+LPQDP +++ +++ + T R +L+ TR Sbjct: 76 IDETWKHNPILPQDPFQRSKARVLAKLVDEKIVNVGFASLAKTEKGREVLIEQTR 130 >At2g29460.1 68415.m03579 glutathione S-transferase, putative Length = 224 Score = 56.0 bits (129), Expect = 2e-08 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 1/81 (1%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDK-PEWLTTKSAFAKVPAIEIAEDVTIYESLVTVE 424 P +R +A K + YE + D+++K P L + KVP + + + + ES V +E Sbjct: 17 PFTRRVEMAFKLKGVPYEYLEQDIVNKSPLLLQINPVYKKVPVL-VYKGKILSESHVILE 75 Query: 425 YLDEVYPKRPLLPQDPLKKAL 487 Y+D+++ P+LPQDP +KA+ Sbjct: 76 YIDQIWKNNPILPQDPYEKAM 96 >At2g29450.1 68415.m03578 glutathione S-transferase (103-1A) identical to Swiss-Prot:P46421 glutathione S-transferase 103-1A [Arabidopsis thaliana] Length = 224 Score = 56.0 bits (129), Expect = 2e-08 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 1/80 (1%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDK-PEWLTTKSAFAKVPAIEIAEDVTIYESLVTVE 424 P +R +AL K I YE V L +K P L KVP + + TI ES V +E Sbjct: 16 PFSRRVEMALKLKGIPYEYVEEILENKSPLLLALNPIHKKVPVL-VHNGKTILESHVILE 74 Query: 425 YLDEVYPKRPLLPQDPLKKA 484 Y+DE +P+ P+LPQDP +++ Sbjct: 75 YIDETWPQNPILPQDPYERS 94 >At2g29490.1 68415.m03582 glutathione S-transferase, putative similar to glutathione S-transferase 103-1A [Arabidopsis thaliana] SWISS-PROT:P46421 Length = 224 Score = 54.0 bits (124), Expect = 1e-07 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDK-PEWLTTKSAFAKVPAIEIAEDVTIYESLVTVE 424 P +R +AL K + YE + DL +K P L KVP + + D + ES + +E Sbjct: 17 PFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVL-VHNDKILLESHLILE 75 Query: 425 YLDEVYPKRPLLPQDPLKKAL 487 Y+D+ + P+LPQDP +KA+ Sbjct: 76 YIDQTWKNSPILPQDPYEKAM 96 >At2g29420.1 68415.m03575 glutathione S-transferase, putative Length = 227 Score = 53.6 bits (123), Expect = 1e-07 Identities = 26/80 (32%), Positives = 43/80 (53%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEY 427 P +R +AL K + YE + D+ +K L + K+ + + I ESLV +EY Sbjct: 19 PFSRRIEIALTLKGVSYEFLEQDITNKSSLLLQLNPVHKMIPVLVHNGKPISESLVILEY 78 Query: 428 LDEVYPKRPLLPQDPLKKAL 487 +DE + P+LPQDP ++ + Sbjct: 79 IDETWRDNPILPQDPYERTM 98 >At1g19570.1 68414.m02437 dehydroascorbate reductase, putative similar to GB:BAA90672 from (Oryza sativa) Length = 213 Score = 53.6 bits (123), Expect = 1e-07 Identities = 28/70 (40%), Positives = 40/70 (57%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEY 427 P QR +L L K + Y++ I+L DKP+W S KVP ++I +D + +S V V Sbjct: 21 PFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKVPVLKI-DDKWVTDSDVIVGI 79 Query: 428 LDEVYPKRPL 457 L+E YP PL Sbjct: 80 LEEKYPDPPL 89 >At1g78320.1 68414.m09127 glutathione S-transferase, putative similar to glutathione transferase GI:2853219 from [Carica papaya] Length = 220 Score = 52.0 bits (119), Expect = 4e-07 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 2/77 (2%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNIDLIDK-PEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEYLDE 436 RT +AL K++ YE DL +K P L K+P + I E I ES++ V+Y+DE Sbjct: 18 RTRIALEEKKVKYEYREEDLSNKSPLLLQMNPIHKKIPVL-IHEGKPICESIIQVQYIDE 76 Query: 437 VYP-KRPLLPQDPLKKA 484 ++P P+LP DP ++A Sbjct: 77 LWPDTNPILPSDPYQRA 93 >At1g17180.1 68414.m02094 glutathione S-transferase, putative Second of three repeated putative glutathione transferases. 72% identical to glutathione transferase [Arabidopsis thaliana] (gi|4006934). Location of ests 191A10T7 (gb|R90188) and 171N13T7 (gb|R65532) Length = 221 Score = 52.0 bits (119), Expect = 4e-07 Identities = 31/80 (38%), Positives = 45/80 (56%), Gaps = 2/80 (2%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNIDLIDK-PEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEYLDE 436 RT +AL K + ++ DL +K P L K+P + I + ESL+ +EY+DE Sbjct: 18 RTRIALEEKNVKFDYREQDLWNKSPILLEMNPVHKKIPVL-IHNGNPVCESLIQIEYIDE 76 Query: 437 VYP-KRPLLPQDPLKKALDK 493 V+P K PLLP DP ++A K Sbjct: 77 VWPSKTPLLPSDPYQRAQAK 96 >At2g29480.1 68415.m03581 glutathione S-transferase, putative similar to Glutathione S-Transferase [Arabidopsis thaliana] gi:940381|16226389|gb|AF428387. Length = 225 Score = 51.2 bits (117), Expect = 7e-07 Identities = 26/82 (31%), Positives = 42/82 (51%) Frame = +2 Query: 242 VLPLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTV 421 + P +R +AL K + YE + DL K L + K + + D + ES V + Sbjct: 15 ISPFSRRVEMALKLKGVPYEYLEEDLPKKSTLLLELNPVHKKVPVLVHNDKLLSESHVIL 74 Query: 422 EYLDEVYPKRPLLPQDPLKKAL 487 EY+D+ + P+LP DP +KA+ Sbjct: 75 EYIDQTWNNNPILPHDPYEKAM 96 >At1g17170.1 68414.m02093 glutathione S-transferase, putative One of three repeated putative glutathione transferases. 72% identical to glutathione transferase [Arabidopsis thaliana] (gi|4006934) Length = 218 Score = 50.0 bits (114), Expect = 2e-06 Identities = 28/76 (36%), Positives = 41/76 (53%), Gaps = 1/76 (1%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEYLDEV 439 RT +AL K++ Y+ DL +K L + K + I + ESL+ +EY+DE Sbjct: 18 RTRIALAEKRVKYDHREEDLWNKSSLLLEMNPVHKKIPVLIHNGKPVCESLIQIEYIDET 77 Query: 440 YP-KRPLLPQDPLKKA 484 +P PLLP DP K+A Sbjct: 78 WPDNNPLLPSDPYKRA 93 >At5g16710.1 68418.m01956 dehydroascorbate reductase, putative Strong similarity to dehydroascorbate reductase [Spinacia oleracea] gi:10952512 gb:AAG24945 Length = 258 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/70 (32%), Positives = 40/70 (57%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEY 427 P Q+ +L + K + Y++ +DL +KPEW S KVP ++ ++ + +S V + Sbjct: 67 PFCQKVLLTMEEKNVPYDMKMVDLSNKPEWFLKISPEGKVPVVKF-DEKWVPDSDVITQA 125 Query: 428 LDEVYPKRPL 457 L+E YP+ PL Sbjct: 126 LEEKYPEPPL 135 >At2g02390.2 68415.m00177 glutathione S-transferase zeta 1 (GSTZ1) (GST18) identical to SP|Q9ZVQ3|GTZ1_ARATH Glutathione S-transferase zeta-class 1 (EC 2.5.1.18) (AtGSTZ1) (Maleylacetone isomerase) (EC 5.2.1.-) (MAI) {Arabidopsis thaliana}; contains Pfam profiles PF02798: Glutathione S-transferase, N-terminal domain and PF00043:Glutathione S-transferase, C-terminal domain Length = 191 Score = 49.2 bits (112), Expect = 3e-06 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 3/80 (3%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNIDLIDKPEW---LTTKSAFAKVPAIEIAEDVTIYESLVTVEYL 430 R +AL K +DYE + ++L+ ++ + VPA+ + DV I +S + YL Sbjct: 22 RVRIALALKGLDYEYIPVNLLKGDQFDSDFKKINPMGTVPAL-VDGDVVINDSFAIIMYL 80 Query: 431 DEVYPKRPLLPQDPLKKALD 490 DE YP+ PLLP+D K+A++ Sbjct: 81 DEKYPEPPLLPRDLHKRAVN 100 >At2g02390.1 68415.m00178 glutathione S-transferase zeta 1 (GSTZ1) (GST18) identical to SP|Q9ZVQ3|GTZ1_ARATH Glutathione S-transferase zeta-class 1 (EC 2.5.1.18) (AtGSTZ1) (Maleylacetone isomerase) (EC 5.2.1.-) (MAI) {Arabidopsis thaliana}; contains Pfam profiles PF02798: Glutathione S-transferase, N-terminal domain and PF00043:Glutathione S-transferase, C-terminal domain Length = 221 Score = 49.2 bits (112), Expect = 3e-06 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 3/80 (3%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNIDLIDKPEW---LTTKSAFAKVPAIEIAEDVTIYESLVTVEYL 430 R +AL K +DYE + ++L+ ++ + VPA+ + DV I +S + YL Sbjct: 22 RVRIALALKGLDYEYIPVNLLKGDQFDSDFKKINPMGTVPAL-VDGDVVINDSFAIIMYL 80 Query: 431 DEVYPKRPLLPQDPLKKALD 490 DE YP+ PLLP+D K+A++ Sbjct: 81 DEKYPEPPLLPRDLHKRAVN 100 >At2g02380.1 68415.m00176 glutathione S-transferase, putative similar to gi:167970 gb:AAA72320 gb:AY052332 Length = 223 Score = 48.4 bits (110), Expect = 5e-06 Identities = 29/80 (36%), Positives = 47/80 (58%), Gaps = 3/80 (3%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNIDLI--DKPEWLTTK-SAFAKVPAIEIAEDVTIYESLVTVEYL 430 R +AL K +DYE + ++L+ D+ + K + VPA+ + DV I +S + YL Sbjct: 25 RVRIALTLKGLDYEYIPVNLLKGDQSDSDFKKINPMGTVPAL-VDGDVVINDSFAIIMYL 83 Query: 431 DEVYPKRPLLPQDPLKKALD 490 D+ YP+ PLLP D K+A++ Sbjct: 84 DDKYPEPPLLPSDYHKRAVN 103 >At1g53680.1 68414.m06108 glutathione S-transferase, putative similar to GI:2853219 from [Carica papaya] Length = 224 Score = 48.4 bits (110), Expect = 5e-06 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 1/90 (1%) Frame = +2 Query: 218 KIASVQHEVLPLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVT 397 K+ + P RT +AL K +++EV DL +K E L + K + I + Sbjct: 7 KVVVLDFWASPYAMRTKVALREKGVEFEVQEEDLWNKSELLLKSNPVHKKVPVLIHNNTP 66 Query: 398 IYESLVTVEYLDEVY-PKRPLLPQDPLKKA 484 I ESL+ V+Y+DE + LP DP +A Sbjct: 67 ISESLIQVQYIDETWTDAASFLPSDPQSRA 96 >At5g62480.1 68418.m07841 glutathione S-transferase, putative Length = 240 Score = 47.6 bits (108), Expect = 8e-06 Identities = 27/80 (33%), Positives = 42/80 (52%), Gaps = 1/80 (1%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEY 427 P +R LAL K I Y+ V DL +K + L + K + + I ESL +EY Sbjct: 18 PYSKRIELALRLKSIPYQFVQEDLQNKSQTLLRYNPVHKKIPVLVHNGKPISESLFIIEY 77 Query: 428 LDEVYPKRP-LLPQDPLKKA 484 +DE + P +LP+DP +++ Sbjct: 78 IDETWSNGPHILPEDPYRRS 97 >At2g29470.1 68415.m03580 glutathione S-transferase, putative similar to glutathione S-transferase [Euphorbia esula] gb:AAF64450.1 GI:7595790 Length = 225 Score = 46.8 bits (106), Expect = 1e-05 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 2/82 (2%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNID--LIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTV 421 P +R +AL K + Y+ ++ D ++ P L + KVP + + + ES + + Sbjct: 17 PFSRRVEMALKLKGVPYDYLDEDYLVVKSPLLLQLNPVYKKVPVL-VHNGKILPESQLIL 75 Query: 422 EYLDEVYPKRPLLPQDPLKKAL 487 EY+D+ + P+LPQ P KA+ Sbjct: 76 EYIDQTWTNNPILPQSPYDKAM 97 >At1g78380.1 68414.m09134 glutathione S-transferase, putative similar to glutathione transferase GI:2853219 from [Carica papaya] Length = 219 Score = 46.8 bits (106), Expect = 1e-05 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 2/77 (2%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNIDLIDK-PEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEYLDE 436 RT +AL K +++E DL +K P L K+P + I + ES++ V+Y+DE Sbjct: 18 RTRIALREKGVEFEYREEDLRNKSPLLLQMNPIHKKIPVL-IHNGKPVNESIIQVQYIDE 76 Query: 437 VYP-KRPLLPQDPLKKA 484 V+ K P+LP DP +A Sbjct: 77 VWSHKNPILPSDPYLRA 93 >At1g75270.1 68414.m08744 dehydroascorbate reductase, putative similar to GI:6939839 from [Oryza sativa] Length = 213 Score = 46.4 bits (105), Expect = 2e-05 Identities = 26/75 (34%), Positives = 41/75 (54%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEY 427 P QR +L L K++ Y+ I++ DKP+W S KVP +++ + + +S V V Sbjct: 21 PFSQRVLLTLEEKKLPYKTHLINVSDKPQWFLDISPEGKVPVVKL-DGKWVADSDVIVGL 79 Query: 428 LDEVYPKRPLLPQDP 472 L+E YP+ P L P Sbjct: 80 LEEKYPE-PSLKTPP 93 >At1g78340.1 68414.m09129 glutathione S-transferase, putative similar to glutathione transferase GI:2853219 from [Carica papaya] Length = 218 Score = 46.0 bits (104), Expect = 3e-05 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 2/88 (2%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDK-PEWLTTKSAFAKVPAIEIAEDVTIYESLVTVE 424 P R +AL K +++E +L DK P L K+P + I + ES+ V+ Sbjct: 14 PFGVRARIALREKGVEFEYREENLRDKSPLLLQMNPVHKKIPVL-IHNGKPVCESMNVVQ 72 Query: 425 YLDEVY-PKRPLLPQDPLKKALDKIIVE 505 Y+DEV+ K P+LP DP ++A + V+ Sbjct: 73 YIDEVWSDKNPILPSDPYQRAQARFWVD 100 >At5g36270.1 68418.m04375 dehydroascorbate reductase, putative similar to dehydroascorbate reductase {Spinacia oleracea} gi:10952511 gb:AF195783, PMID:11148269 Length = 217 Score = 44.4 bits (100), Expect = 8e-05 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 4/89 (4%) Frame = +2 Query: 218 KIASVQHEVL---PLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAE 388 K AS +VL P QR +L L K++ Y+ ID+ KP+W S K+P ++ E Sbjct: 8 KAASGAPDVLGDCPFGQRILLTLEDKKLPYKTHLIDVSLKPDWFLAISPKGKLPLVKFDE 67 Query: 389 DVT-IYESLVTVEYLDEVYPKRPLLPQDP 472 D + +S + V ++E YP+ L+ P Sbjct: 68 DENWVADSDLIVGIIEEKYPEPSLVTFPP 96 >At1g74590.1 68414.m08640 glutathione S-transferase, putative similar to putative glutathione S-transferase GB:CAA10060 [Arabidopsis thaliana]; contains Pfam profile: PF00043 Glutathione S-transferases Length = 232 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 1/77 (1%) Frame = +2 Query: 257 QRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEYLDE 436 +R +AL K + YE + DL +K E L + K + + + + ESLV +EY+DE Sbjct: 20 KRVEIALKLKGVLYEYLEEDLQNKSESLIQLNPVHKKIPVLVHDGKPVAESLVILEYIDE 79 Query: 437 VYPKRP-LLPQDPLKKA 484 + P P+DP ++A Sbjct: 80 TWTNSPRFFPEDPYERA 96 >At2g02390.3 68415.m00179 glutathione S-transferase zeta 1 (GSTZ1) (GST18) identical to SP|Q9ZVQ3|GTZ1_ARATH Glutathione S-transferase zeta-class 1 (EC 2.5.1.18) (AtGSTZ1) (Maleylacetone isomerase) (EC 5.2.1.-) (MAI) {Arabidopsis thaliana}; contains Pfam profiles PF02798: Glutathione S-transferase, N-terminal domain and PF00043:Glutathione S-transferase, C-terminal domain Length = 228 Score = 43.6 bits (98), Expect = 1e-04 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 10/87 (11%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNIDLIDKPEWLTTK----------SAFAKVPAIEIAEDVTIYES 409 R +AL K +DYE + ++L+ ++ + + VPA+ + DV I +S Sbjct: 22 RVRIALALKGLDYEYIPVNLLKGDQFDSVYRFDLQDFKKINPMGTVPAL-VDGDVVINDS 80 Query: 410 LVTVEYLDEVYPKRPLLPQDPLKKALD 490 + YLDE YP+ PLLP+D K+A++ Sbjct: 81 FAIIMYLDEKYPEPPLLPRDLHKRAVN 107 >At5g02780.1 68418.m00220 In2-1 protein, putative similar to In2-1 [Zea mays] EMBL:X58573 Length = 237 Score = 43.2 bits (97), Expect = 2e-04 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 3/81 (3%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEV--VNIDLIDKPEWLTTK-SAFAKVPAIEIAEDVTIYESLVT 418 P QR + N K + E+ V IDL ++P WL K + KVPA+E +T ESL Sbjct: 40 PFAQRVWITRNLKGLQDEIKLVPIDLPNRPAWLKEKVNPANKVPALEHNGKIT-GESLDL 98 Query: 419 VEYLDEVYPKRPLLPQDPLKK 481 ++Y+D + L P+D K+ Sbjct: 99 IKYVDSNFDGPSLYPEDSAKR 119 >At1g17190.1 68414.m02095 glutathione S-transferase, putative One of three repeated glutathione transferases. 65% identical to glutathione transferase [Arabidopsis thaliana] (gi|4006934). Location of est 141C5T7 (gb|T46669); supported by fl cDNA gi:14326476gb:AF385691. Length = 220 Score = 43.2 bits (97), Expect = 2e-04 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 2/77 (2%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNID-LIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEYLDE 436 RT +AL K + YE D + P + K+P + I I ESL+ +EY+DE Sbjct: 19 RTKMALAEKGVKYEYKETDPWVKTPLLIEMNPIHKKIPVL-IHNGKPICESLIQLEYIDE 77 Query: 437 VY-PKRPLLPQDPLKKA 484 V+ P+LP DP +K+ Sbjct: 78 VWSDASPILPSDPYQKS 94 >At3g09270.1 68416.m01101 glutathione S-transferase, putative similar to glutathione transferase GB:CAA71784 [Glycine max] Length = 224 Score = 42.7 bits (96), Expect = 2e-04 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 3/83 (3%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDK--PEWLTTKSAFAKVPAIEIAEDVTIYESLVTV 421 P +R + L K I YE + D+ P L KVP + I +I ESLV V Sbjct: 16 PFSKRVEMVLKLKGIPYEYIEEDVYGNRSPMLLKYNPIHKKVPVL-IHNGRSIAESLVIV 74 Query: 422 EYLDEVY-PKRPLLPQDPLKKAL 487 EY+++ + +LPQDP ++A+ Sbjct: 75 EYIEDTWKTTHTILPQDPYERAM 97 >At1g27140.1 68414.m03307 glutathione S-transferase, putative similar to glutathione S-transferase GB: AAF22517 GI:6652870 from [Papaver somniferum] GB:AY050343. Length = 243 Score = 42.3 bits (95), Expect = 3e-04 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 4/83 (4%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVV---NIDLIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVT 418 P R +AL+ K I YE + + DL +K + L + K + I D+ I ESL Sbjct: 16 PFSIRPRVALHLKSIKYEYLEEPDDDLGEKSQLLLKSNPIHKKTPVLIHGDLAICESLNI 75 Query: 419 VEYLDEVYPKRP-LLPQDPLKKA 484 V+YLDE +P P +LP + +A Sbjct: 76 VQYLDEAWPSDPSILPSNAYDRA 98 >At1g27130.1 68414.m03306 glutathione S-transferase, putative similar to glutathione S-transferase GB: AAF22517 GI:6652870 from [Papaver somniferum] Length = 227 Score = 41.9 bits (94), Expect = 4e-04 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 3/82 (3%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNID--LIDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTV 421 P R +AL+ K + YE ++ L +K E L + K + + D++I ESL V Sbjct: 16 PYSLRARVALHLKSVKYEYLDEPDVLKEKSELLLKSNPIHKKVPVLLHGDLSISESLNVV 75 Query: 422 EYLDEVYPKRP-LLPQDPLKKA 484 +Y+DE +P P +LP D +A Sbjct: 76 QYVDEAWPSVPSILPSDAYDRA 97 >At1g78360.1 68414.m09132 glutathione S-transferase, putative similar to glutathione transferase GI:2853219 from [Carica papaya] Length = 222 Score = 41.5 bits (93), Expect = 6e-04 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 2/77 (2%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNIDLID-KPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEYLDE 436 RT++AL K + YE D+I+ K L + K + I + ESL+ ++Y+DE Sbjct: 18 RTMIALEEKGVKYEYREEDVINNKSPLLLEMNPIHKTIPVLIHNGKPVLESLIQIQYIDE 77 Query: 437 VY-PKRPLLPQDPLKKA 484 V+ LP DP +A Sbjct: 78 VWSDNNSFLPSDPYHRA 94 >At1g78370.1 68414.m09133 glutathione S-transferase, putative similar to 2,4-D inducible glutathione S-transferase GI:2920666 from [Glycine max] Length = 217 Score = 41.1 bits (92), Expect = 7e-04 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 2/77 (2%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNIDLIDK-PEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEYLDE 436 R +AL K +++E D +K P L + K+P + + + ESL V+Y+DE Sbjct: 18 RARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVL-VHNGKPVCESLNVVQYVDE 76 Query: 437 VYP-KRPLLPQDPLKKA 484 +P K P P DP +A Sbjct: 77 AWPEKNPFFPSDPYGRA 93 >At3g55040.1 68416.m06112 In2-1 protein, putative similar to In2-1 protein, Zea mays, P49248 Length = 292 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 3/81 (3%) Frame = +2 Query: 248 PLPQRTILALNAK--QIDYEVVNIDLIDKPEWLTTKSAFA-KVPAIEIAEDVTIYESLVT 418 P QR +A N K Q E+V IDL ++P W K A KVPA+E V + ESL Sbjct: 90 PFAQRAWIARNYKGLQNKIELVPIDLKNRPAWYKEKVYSANKVPALEHNNRV-LGESLDL 148 Query: 419 VEYLDEVYPKRPLLPQDPLKK 481 ++Y+D + + P L D L+K Sbjct: 149 IKYIDTNF-EGPSLTPDGLEK 168 >At1g59700.1 68414.m06716 glutathione S-transferase, putative similar to glutathione S-transferase GB:AAF29773 GI:6856103 from [Gossypium hirsutum] Length = 234 Score = 39.9 bits (89), Expect = 0.002 Identities = 29/84 (34%), Positives = 40/84 (47%), Gaps = 4/84 (4%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKS--AFAKVPAIEIAEDVTIYESLVTV 421 P R +AL K +DY+ V +L L KS KVP + + + I ESL V Sbjct: 16 PYAIRPKIALRLKSVDYDYVEENLFGSKSELLLKSNPVHKKVPVL-LHNNKPIVESLNIV 74 Query: 422 EYLDEVYPKR--PLLPQDPLKKAL 487 EY+DE + +LP P +AL Sbjct: 75 EYIDETWNSSAPSILPSHPYDRAL 98 >At5g02790.1 68418.m00221 In2-1 protein, putative similar to In2-1, Zea mays, EMBL:X58573 Length = 235 Score = 39.5 bits (88), Expect = 0.002 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 3/83 (3%) Frame = +2 Query: 242 VLPLPQRTILALNAKQIDYEV--VNIDLIDKPEWLTTKS-AFAKVPAIEIAEDVTIYESL 412 V P QR + N K + ++ V +DL ++P W K KVPA+E + I ESL Sbjct: 36 VCPFAQRVWITRNFKGLQEKIKLVPLDLGNRPAWYKEKVYPENKVPALEHNGKI-IGESL 94 Query: 413 VTVEYLDEVYPKRPLLPQDPLKK 481 ++YLD + L P+D K+ Sbjct: 95 DLIKYLDNTFEGPSLYPEDHAKR 117 >At1g69920.1 68414.m08046 glutathione S-transferase, putative similar to glutathione transferase GB:CAA09188 [Alopecurus myosuroides]; supported by cDNA gi:15451157 gb:AY050343. Length = 254 Score = 38.3 bits (85), Expect = 0.005 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 4/83 (4%) Frame = +2 Query: 248 PLPQRTILALNAKQIDYEVVN-IDLIDKPEWLTTKS--AFAKVPAIEIAEDVTIYESLVT 418 P R +AL+ K +++E V D++ L KS KVP + I DV+I ESL Sbjct: 44 PFAIRAQVALHLKSVEHEYVEETDVLKGKSDLLIKSNPIHKKVPVL-IHGDVSICESLNI 102 Query: 419 VEYLDEVYPK-RPLLPQDPLKKA 484 V+Y+DE +P +LP P ++A Sbjct: 103 VQYVDESWPSDLSILPTLPSERA 125 >At3g43800.1 68416.m04681 glutathione S-transferase, putative glutathione transferase, papaya, PIR:T09781 Length = 227 Score = 37.9 bits (84), Expect = 0.007 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 4/79 (5%) Frame = +2 Query: 260 RTILALNAKQIDYEVVNIDLI-DKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTVEYLDE 436 R I+AL K+I +E D+ K + L + K + I + ES + VEY+DE Sbjct: 19 RVIMALEEKEIKFEYKEEDVFGQKTDLLLQSNPVNKKIPVLIHNGKPVCESNIIVEYIDE 78 Query: 437 VYPKRP---LLPQDPLKKA 484 V+ LLP DP +K+ Sbjct: 79 VWKDDKTLRLLPSDPYQKS 97 >At5g17220.1 68418.m02018 glutathione S-transferase, putative Length = 214 Score = 37.5 bits (83), Expect = 0.009 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +2 Query: 254 PQRTILALNAKQIDYEVVNIDL----IDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTV 421 PQR +L K I++E+++IDL KPE L + F +VPAIE D ++ES Sbjct: 14 PQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHL-LRQPFGQVPAIEDG-DFKLFESRAIA 71 Query: 422 EY 427 Y Sbjct: 72 RY 73 >At2g47730.1 68415.m05960 glutathione S-transferase 6 (GST6) identical to GB:X95295. Based on identical cDNA hits, the translation is now 40 AAs longer at the N-terminal, and start of exon2 is also corrected. Length = 263 Score = 36.7 bits (81), Expect = 0.016 Identities = 25/91 (27%), Positives = 48/91 (52%), Gaps = 8/91 (8%) Frame = +2 Query: 221 IASVQHEVLPLP---QRTILALNAKQIDYEVVNIDL---IDKPEWLTTKSAFAKVPAIEI 382 +AS++ +P+ R + L K + +E++ +D+ K E + F ++PA+E Sbjct: 49 MASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALED 108 Query: 383 AEDVTIYESLVTVEYLDEVYPKR--PLLPQD 469 D+T++ES +YL E Y ++ L+ QD Sbjct: 109 G-DLTLFESRAITQYLAEEYSEKGEKLISQD 138 >At3g03190.1 68416.m00315 glutathione S-transferase, putative identical to glutathione S-transferase GB:AAB09584 from [Arabidopsis thaliana] Length = 214 Score = 35.1 bits (77), Expect = 0.048 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 4/67 (5%) Frame = +2 Query: 254 PQRTILALNAKQIDYEVVNIDL----IDKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTV 421 PQR +L K I++EV+++DL KP+ L + F +VPAIE + ++ES Sbjct: 14 PQRVLLCFLEKDIEFEVIHVDLDKLEQKKPQHL-LRQPFGQVPAIEDGY-LKLFESRAIA 71 Query: 422 EYLDEVY 442 Y Y Sbjct: 72 RYYATKY 78 >At2g30860.1 68415.m03761 glutathione S-transferase, putative identical to GB:Y12295 Length = 215 Score = 33.1 bits (72), Expect = 0.19 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 4/67 (5%) Frame = +2 Query: 254 PQRTILALNAKQIDYEVVNIDLI----DKPEWLTTKSAFAKVPAIEIAEDVTIYESLVTV 421 P+R ++ L K + +E + +DL+ +P +L + F VPA+ + D I+ES + Sbjct: 13 PKRALVTLIEKGVAFETIPVDLMKGEHKQPAYLALQ-PFGTVPAV-VDGDYKIFESRAVM 70 Query: 422 EYLDEVY 442 Y+ E Y Sbjct: 71 RYVAEKY 77 >At5g40000.1 68418.m04851 AAA-type ATPase family protein BCS1 nuclear gene encoding mitochondrial protein - Homo sapiens, EMBL:AF026849 contains Pfam profile: ATPase family PF00004 Length = 470 Score = 31.1 bits (67), Expect = 0.78 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 138 SAIKDSRNINFNTKHLRKGDPLPPFNGKLRVY-NMRYCPYLSEPF*LLTRNKLTM 299 SA R + F T HL K DP G++ ++ + YC Y E F +L +N L + Sbjct: 346 SACGQERIVVFTTNHLEKLDPALIRRGRMDMHIELSYCTY--EAFKILAKNYLDL 398 >At1g71210.1 68414.m08217 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 879 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 439 LSEKAFTAARSFEESIGQNYCRSTAPIQSLFIKILKFSDTVNEEHVAAYH 588 + EK +T RS ++ Q C + ++ F +LKF ++ E V AY+ Sbjct: 558 MQEKGYTPTRSLYRNVIQCVCEMESGEKNFFTTLLKFQLSLWEHKVQAYN 607 >At5g42150.1 68418.m05131 expressed protein Length = 315 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/77 (22%), Positives = 37/77 (48%) Frame = +2 Query: 218 KIASVQHEVLPLPQRTILALNAKQIDYEVVNIDLIDKPEWLTTKSAFAKVPAIEIAEDVT 397 ++ Q+E P + L+ +I Y+VV ++ I K E S + KVP + + + Sbjct: 87 EVVLYQYEACPFCNKVKAFLDYNKIPYKVVEVNPISKKE--IKWSDYKKVPILTVDGEQM 144 Query: 398 IYESLVTVEYLDEVYPK 448 + S++ +++P+ Sbjct: 145 VDSSVIIDSLFQKMHPE 161 >At5g41860.1 68418.m05097 expressed protein Length = 192 Score = 28.7 bits (61), Expect = 4.2 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Frame = +2 Query: 314 DLIDKPEWLTTKSAF----AKVPAIEIAEDVTIYESLVTVEYLDEVYPKRPLLPQDPLKK 481 D+IDK TT SA + P++ +++VT+ + V ++ +P+RPL P K+ Sbjct: 53 DIIDK-SLTTTSSAEPDPDSTNPSLSESDEVTVPVNFVNFHPINRHFPRRPLTTTAPFKR 111 >At3g28610.1 68416.m03571 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 473 Score = 28.3 bits (60), Expect = 5.5 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +3 Query: 138 SAIKDSRNINFNTKHLRKGDPLPPFNGKLRVY-NMRYCPYLSEPF*LLTRNKLTM 299 SA R I F T HL K DP G++ ++ + YC + E F L +N L + Sbjct: 345 SACGQERIIVFTTNHLAKLDPALIRRGRMDMHIELSYCTF--EAFKTLAKNYLDL 397 >At3g28600.1 68416.m03570 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 475 Score = 28.3 bits (60), Expect = 5.5 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +3 Query: 138 SAIKDSRNINFNTKHLRKGDPLPPFNGKLRVY-NMRYCPYLSEPF*LLTRNKLTM 299 SA R I F T H K DP G++ ++ + YC + E F +L +N L + Sbjct: 344 SACGQERIIIFTTNHFEKLDPALIRRGRMDMHIELSYCSF--EAFKILAKNYLDL 396 >At3g06500.1 68416.m00754 beta-fructofuranosidase, putative / invertase, putative / saccharase, putative / beta-fructosidase, putative similar to neutral invertase [Daucus carota] GI:4200165; contains Pfam profile PF04853: Plant neutral invertase Length = 664 Score = 27.9 bits (59), Expect = 7.3 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +3 Query: 24 STVSLAMHLIYSSFQGVRVISQVLEYVLPYTGVPFRNMSAIKDSRNINFNTKHLRK 191 ST SL H+ SF+ + V V + V G+P R + ++ NF +RK Sbjct: 113 STSSLDSHVNDKSFESMFVKPLVFKEVEKTEGIPKRERGNVGGGKDANFGNVGVRK 168 >At2g37780.1 68415.m04639 DC1 domain-containing protein contains Pfam PF03107: DC1 domain Length = 286 Score = 27.5 bits (58), Expect = 9.6 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +3 Query: 156 RNINFNTKHLRKGDPLPPFNGKLRVYNMRYCPYLS 260 + I + H+ + +P PP G + N Y PY++ Sbjct: 142 QGIPYGYPHMGQPEPYPPQGGGYQPQNQNYYPYMN 176 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,909,718 Number of Sequences: 28952 Number of extensions: 293215 Number of successful extensions: 809 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 804 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -