BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30344 (411 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1294 - 36076524-36076554,36076821-36076891,36077221-360772... 67 4e-12 05_05_0108 + 22451440-22451541,22452228-22452427,22452979-22453018 66 1e-11 07_03_0078 - 13147741-13148913 30 0.63 >01_06_1294 - 36076524-36076554,36076821-36076891,36077221-36077275, 36077363-36077562,36078614-36078715 Length = 152 Score = 67.3 bits (157), Expect = 4e-12 Identities = 39/78 (50%), Positives = 46/78 (58%) Frame = +3 Query: 21 PRFEIAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQ 200 P+ + VG+ KGH TK + + RP+ KG TK FVR L+REVVG A Sbjct: 6 PKSGLFVGINKGHVVTK----------RELPPRPSDRKGKSTKRVNFVRGLIREVVGFAP 55 Query: 201 YEKRAMELLKVSKDKRAL 254 YEKR ELLKV KDKRAL Sbjct: 56 YEKRITELLKVGKDKRAL 73 Score = 39.1 bits (87), Expect = 0.001 Identities = 16/25 (64%), Positives = 22/25 (88%) Frame = +2 Query: 263 KRRLGTHIRAKRKREELSNVLAQMR 337 KR+LGTH RAK+KREE++ V+ +MR Sbjct: 77 KRKLGTHKRAKKKREEMAGVIRKMR 101 >05_05_0108 + 22451440-22451541,22452228-22452427,22452979-22453018 Length = 113 Score = 66.1 bits (154), Expect = 1e-11 Identities = 38/78 (48%), Positives = 46/78 (58%) Frame = +3 Query: 21 PRFEIAVGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQ 200 P+ + VG+ KGH TK + + RP+ KG TK FVR+L+REV G A Sbjct: 6 PKSGLFVGINKGHVVTK----------RELPPRPSDRKGKSTKRVTFVRNLIREVAGFAP 55 Query: 201 YEKRAMELLKVSKDKRAL 254 YEKR ELLKV KDKRAL Sbjct: 56 YEKRITELLKVGKDKRAL 73 Score = 39.9 bits (89), Expect = 8e-04 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = +2 Query: 263 KRRLGTHIRAKRKREELSNVLAQMR 337 KR+LGTH RAK+KREE++ VL +MR Sbjct: 77 KRKLGTHKRAKKKREEMAGVLRKMR 101 >07_03_0078 - 13147741-13148913 Length = 390 Score = 30.3 bits (65), Expect = 0.63 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 124 AGLILMALSVIPLRPADILVVLWPF 50 AGL+ AL VIP P + +V WPF Sbjct: 71 AGLLYFALVVIPALPGVLRLVAWPF 95 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,693,868 Number of Sequences: 37544 Number of extensions: 173038 Number of successful extensions: 413 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 730630428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -