BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30341 (310 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 23 0.55 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 22 1.7 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 20 5.2 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 23.4 bits (48), Expect = 0.55 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 108 KQLLCEGRGKEEKVLEFLMSRHTPP 182 K L+CE G+ E L S TPP Sbjct: 187 KNLICEIDGRHEFFLAEFKSAKTPP 211 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.8 bits (44), Expect = 1.7 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -1 Query: 163 IRNSSTFSSFPLPSHSNCFSVI 98 IRN T F LP+ NC + Sbjct: 10 IRNRGTPPKFELPTTHNCLKKV 31 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 20.2 bits (40), Expect = 5.2 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +3 Query: 72 KQIPSTIAAMTEKQLLCEGRGKEEKVLEFLMSRHTPPYPSALSSL 206 + IP+++AA Q GRG +K+ + R Y +L + Sbjct: 110 QHIPASVAAAFAPQGPSTGRGASKKLSKVETLRLAVEYIRSLKQM 154 Score = 20.2 bits (40), Expect = 5.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 151 STFSSFPLPSHSNCFSVIAA 92 S SS P PSHS+ S AA Sbjct: 197 SEASSSPTPSHSSESSFSAA 216 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,179 Number of Sequences: 336 Number of extensions: 949 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5624413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -