BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30341 (310 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB18E9.01 |trm5||tRNA |Schizosaccharomyces pombe|chr 1|||Manual 28 0.37 SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 27 0.64 SPAC17H9.19c |cdt2|sev1|WD repeat protein Cdt2|Schizosaccharomyc... 25 3.4 SPCC188.07 |ccq1||telomere maintenence protein|Schizosaccharomyc... 24 4.5 SPAC26H5.03 |||WD repeat protein Cac2|Schizosaccharomyces pombe|... 23 7.9 SPBC13G1.08c |ash2||Ash2-trithorax family protein|Schizosaccharo... 23 7.9 SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyce... 23 7.9 >SPAPB18E9.01 |trm5||tRNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 435 Score = 27.9 bits (59), Expect = 0.37 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = +2 Query: 11 NEVFNFIEDLQGGMRDIDRDKTDTINNSCNDRKAVTM*REREGRKGARVSDE*AYTTISI 190 N+V NF++ R+ R + D KA+T+ R+ + + + I I Sbjct: 285 NKVANFVKAFNQDGREFIRSSVQKLLGFSKDEKAITVFPPRKRARKLEENKDPVRQDIPI 344 Query: 191 SPVFS 205 PVFS Sbjct: 345 PPVFS 349 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 27.1 bits (57), Expect = 0.64 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 160 RNSSTFSSFPLPSHSNCFSVIAAIV 86 RN S S P P+H N FS+I I+ Sbjct: 1027 RNLSMHWSIPFPTHHNFFSIIPFIL 1051 >SPAC17H9.19c |cdt2|sev1|WD repeat protein Cdt2|Schizosaccharomyces pombe|chr 1|||Manual Length = 490 Score = 24.6 bits (51), Expect = 3.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 248 KARFCIQNPWLFVLKRRQG*WIWWCMPTH 162 + FC +P+ V R G I+W M TH Sbjct: 233 QVNFCNDSPYNLVSCSRDGSIIFWDMRTH 261 >SPCC188.07 |ccq1||telomere maintenence protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 735 Score = 24.2 bits (50), Expect = 4.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 217 YSCLREDRADGYGGVCLLIRNSSTFSSFPLP 125 +S + E D V ++N FSS+PLP Sbjct: 397 HSSITEKTRDIAKNVATWLKNGENFSSWPLP 427 >SPAC26H5.03 |||WD repeat protein Cac2|Schizosaccharomyces pombe|chr 1|||Manual Length = 512 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 177 VYAYSSETLAPFLPSLSLH 121 VY Y ++T PF +++LH Sbjct: 400 VYIYDTQTCKPFYRAVNLH 418 >SPBC13G1.08c |ash2||Ash2-trithorax family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 652 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 48 PPCKSSMKLKTSFQF 4 PPC S M T++QF Sbjct: 72 PPCTSMMGFSTNYQF 86 >SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 2104 Score = 23.4 bits (48), Expect = 7.9 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -1 Query: 157 NSSTFSSFPLPSHSNCFSVIAAIVDGICFVSIYVPHPS 44 NSS F F SN S++ A +D V HPS Sbjct: 237 NSSRFGKFIRIEFSNNGSIVGANLDWYLLEKSRVIHPS 274 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,025,827 Number of Sequences: 5004 Number of extensions: 17184 Number of successful extensions: 50 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 79841814 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -