BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30341 (310 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0660 + 5029070-5029177,5029303-5029398,5029494-5029556,502... 26 5.2 10_01_0003 + 46158-46428,46588-46706,46819-46928,48977-49415,495... 26 6.9 06_03_0999 - 26752410-26752523,26752601-26752830,26752914-267531... 26 6.9 06_01_0240 - 1822086-1822216,1822311-1822367,1822788-1822842,182... 26 6.9 >01_01_0660 + 5029070-5029177,5029303-5029398,5029494-5029556, 5029836-5029913,5030446-5030614,5030797-5031180, 5031959-5032042,5032143-5032288,5032810-5033070, 5033147-5033328,5033421-5033586,5033650-5033703, 5034702-5034965,5035088-5035303,5035388-5035540, 5035630-5035827 Length = 873 Score = 26.2 bits (55), Expect = 5.2 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -1 Query: 100 IAAIVDGICFVSIYVPHPSLQIFNEIKNFISVL 2 IA +++ C + +L I+NEI+NFI+V+ Sbjct: 820 IAGVLERACLMLRPSCAENLPIYNEIENFIAVI 852 >10_01_0003 + 46158-46428,46588-46706,46819-46928,48977-49415, 49511-49633,49805-50106,50143-50350,50729-51448 Length = 763 Score = 25.8 bits (54), Expect = 6.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 121 HSNCFSVIAAIVDGICFVSIYVPHPSL 41 H + ++I A D +C V YVP+ SL Sbjct: 533 HPHLVTLIGACPDALCLVYEYVPNGSL 559 >06_03_0999 - 26752410-26752523,26752601-26752830,26752914-26753169, 26753763-26753828,26753921-26754046,26754148-26754288, 26754377-26754387,26754523-26754670,26755326-26755454, 26755573-26755710,26755808-26755876,26755955-26756023, 26756565-26756720,26756885-26756985,26757068-26757215, 26757540-26757702,26757833-26757965,26758049-26758226, 26758330-26758572,26758664-26758732,26759063-26759187, 26759727-26759766,26760756-26760812,26762831-26762935 Length = 1004 Score = 25.8 bits (54), Expect = 6.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 171 HTPPYPSALSSLKHE*PGILNTKSGFSQF 257 H P A SSL H+ IL+TKS QF Sbjct: 210 HVKEVPFARSSLNHDDIFILDTKSKIFQF 238 >06_01_0240 - 1822086-1822216,1822311-1822367,1822788-1822842, 1824585-1824674,1824848-1824995,1825095-1825351 Length = 245 Score = 25.8 bits (54), Expect = 6.9 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -1 Query: 202 EDRADGYGGVCLLIR-NSSTFSSFPLPSHS 116 E R DGY V L++ N TF+ PL SH+ Sbjct: 100 EMRTDGYVRVRDLLKLNLQTFAKIPLKSHT 129 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,510,587 Number of Sequences: 37544 Number of extensions: 112775 Number of successful extensions: 294 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 294 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 375959444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -