BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30341 (310 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY180919-1|AAN87272.1| 884|Drosophila melanogaster ORF1 protein. 29 1.2 AE014296-636|AAF47758.2| 296|Drosophila melanogaster CG12077-PA... 27 4.7 >AY180919-1|AAN87272.1| 884|Drosophila melanogaster ORF1 protein. Length = 884 Score = 29.1 bits (62), Expect = 1.2 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -1 Query: 253 WLKPDFVFKIPGYSCLREDRADGY-GGVCLLIRNSSTFSSFP-LPSH 119 WL F IP Y+ R DR + GGV + + N+ P + SH Sbjct: 47 WLTHSDRFNIPEYTIYRNDRKESRGGGVAIAVSNTLIHEQIPCIKSH 93 >AE014296-636|AAF47758.2| 296|Drosophila melanogaster CG12077-PA protein. Length = 296 Score = 27.1 bits (57), Expect = 4.7 Identities = 16/72 (22%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Frame = -1 Query: 220 GYSCLREDRADGYGGVCLLIRNSSTFSSFPLPSHSNCFSVIAAIVDGICFVSIY-VPHPS 44 G CL Y LL+ + F +P+ + +N + + IC +++Y + P Sbjct: 187 GAICLASRLPTSYHAFVLLVEAAVFFVLYPIMTEANWHAGFMLPIFAICCMALYCISRPV 246 Query: 43 LQIFNEIKNFIS 8 L ++ FI+ Sbjct: 247 LYLYASTTIFIN 258 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,019,989 Number of Sequences: 53049 Number of extensions: 191358 Number of successful extensions: 432 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 589756776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -