BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30341 (310 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g03620.1 68417.m00497 myosin heavy chain-related contains wea... 29 0.84 At5g01660.1 68418.m00082 kelch repeat-containing protein similar... 27 2.6 At4g32890.1 68417.m04680 zinc finger (GATA type) family protein ... 27 2.6 At1g64940.1 68414.m07361 cytochrome P450, putative similar to cy... 27 3.4 At1g16130.1 68414.m01933 wall-associated kinase, putative simila... 27 3.4 At1g09720.1 68414.m01091 kinase interacting family protein simil... 27 3.4 At1g10720.1 68414.m01221 BSD domain-containing protein contains ... 26 4.5 At4g30160.1 68417.m04289 villin, putative similar to villin 2 (... 26 5.9 At3g28030.1 68416.m03499 UV hypersensitive protein (UVH3) / DNA-... 25 7.8 At1g77740.1 68414.m09051 1-phosphatidylinositol-4-phosphate 5-ki... 25 7.8 >At4g03620.1 68417.m00497 myosin heavy chain-related contains weak similarity to Swiss-Prot:P24733 myosin heavy chain, striated muscle [Aequipecten irradians] Length = 342 Score = 28.7 bits (61), Expect = 0.84 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +3 Query: 72 KQIPSTIAAMTEKQLLCEGRGKEEKVLEFLMSR 170 K++ +++AA Q++C GKE++++ +SR Sbjct: 164 KELSASMAARKSLQMMCSSLGKEKEIMALELSR 196 >At5g01660.1 68418.m00082 kelch repeat-containing protein similar to SP|P57790 Kelch-like ECH-associated protein 1 (Cytosolic inhibitor of Nrf2) {Rattus norvegicus}; contains Pfam profile PF01344: Kelch motif Length = 621 Score = 27.1 bits (57), Expect = 2.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 88 VDGICFVSIYVPHPSLQIFNEIK 20 +DG C VS +PH Q+ +E+K Sbjct: 247 IDGSCLVSSPLPHTISQLMHEVK 269 >At4g32890.1 68417.m04680 zinc finger (GATA type) family protein GATA transcription factor 3, Arabidopsis thaliana, gb:Y13650 Length = 308 Score = 27.1 bits (57), Expect = 2.6 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -1 Query: 157 NSSTFSSFPLPSHSNCFSVIAAIVDGICFVSIYVPHPSLQIFNEIKNFI 11 +SST S+ L SN S+ DG F +Y+P+ + + NF+ Sbjct: 42 DSSTLSTGTLTDSSNSSSLFT---DGTGFSDLYIPNDDIAELEWLSNFV 87 >At1g64940.1 68414.m07361 cytochrome P450, putative similar to cytochrome p450 GI:438242 from [Solanum melongena] Length = 511 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -1 Query: 169 LLIRNSSTFSSFPLPSHSNCFSVIAAI 89 LL R +FSS PLP N F I + Sbjct: 20 LLFRRRDSFSSLPLPPDPNFFPFIGTL 46 >At1g16130.1 68414.m01933 wall-associated kinase, putative similar to putative serine/threonine-specific protein kinase GI:7270012 from [Arabidopsis thaliana] Length = 748 Score = 26.6 bits (56), Expect = 3.4 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 38 LQGGMRDIDRDKTDTINNSCNDRKAVTM 121 L GG D+D K D N C D+ V + Sbjct: 298 LPGGCVDVDECKLDIGRNQCKDQSCVNL 325 >At1g09720.1 68414.m01091 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 928 Score = 26.6 bits (56), Expect = 3.4 Identities = 13/37 (35%), Positives = 25/37 (67%) Frame = +2 Query: 35 DLQGGMRDIDRDKTDTINNSCNDRKAVTM*REREGRK 145 +LQ +RD+++DK +++S + +K +T+ E E RK Sbjct: 371 ELQDHIRDVEKDKACLVSDSMDMKKRITV-LEDELRK 406 >At1g10720.1 68414.m01221 BSD domain-containing protein contains Pfam profile PF03909: BSD domain Length = 429 Score = 26.2 bits (55), Expect = 4.5 Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = +2 Query: 23 NFIEDLQGGMRDIDRDKTDTINNSCNDRKAVTM*RERE--GRKGARVSDE 166 NF+E L G+ D D D NN ND K ER R R+S E Sbjct: 4 NFLESLYDGIGDDDAADDDEDNN--NDEKTPKASTERHDFSRNAVRLSPE 51 >At4g30160.1 68417.m04289 villin, putative similar to villin 2 (VLN2) [Arabidopsis thaliana] GI:3415115, villin 3 (VLN3) [Arabidopsis thaliana] GI:3415117; contains Pfam profiles PF00626: Gelsolin repeat, PF02209: Villin headpiece domain Length = 974 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 171 HTPPYPSALSSLKHE*PGILNTKSGFSQF 257 H P A SSL H+ IL+TKS QF Sbjct: 151 HVKEVPFARSSLNHDDIYILDTKSKIFQF 179 >At3g28030.1 68416.m03499 UV hypersensitive protein (UVH3) / DNA-repair protein, putative identical to UV hypersensitive protein [Arabidopsis thaliana] gi|13649704|gb|AAK37472; similar to Swiss-Prot:P14629 DNA-repair protein complementing XP-G cells homolog (Xeroderma pigmentosum group G complementing protein homolog) [Xenopus laevis] Length = 1479 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +2 Query: 44 GGMRDIDRDKTDTINNSCNDRKAVTM*REREGRKGARVSDE 166 GG +D D+T N +D + + M E + +KG R ++E Sbjct: 1406 GGGFCVDEDETAEENTMDDDAEILKMESEEQRKKGKRRNEE 1446 >At1g77740.1 68414.m09051 1-phosphatidylinositol-4-phosphate 5-kinase, putative / PIP kinase, putative / PtdIns(4)P-5-kinase, putative / diphosphoinositide kinase, putative strong similarity to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF02493: MORN repeat Length = 754 Score = 25.4 bits (53), Expect = 7.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 66 ETKQIPSTIAAMTEKQLLCEGRGKEEKVLE 155 E ++ +T + EK LC+ RG EEK E Sbjct: 9 EEEEEEATEVLLVEKTKLCKRRGDEEKTEE 38 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,386,542 Number of Sequences: 28952 Number of extensions: 92669 Number of successful extensions: 276 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 276 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 321405440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -