BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30340X (585 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 23 5.5 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 5.5 Y17699-1|CAA76819.1| 81|Anopheles gambiae hypothetical protein... 23 9.6 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.4 bits (48), Expect = 5.5 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 117 NNRTTSEDINDRTISQKRPESTSSSDIIARTRSPSV 224 N++T S D + T S TSS + RSP V Sbjct: 129 NSQTRSFDCDSSTGSMASAPGTSSVPLTIHRRSPGV 164 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.4 bits (48), Expect = 5.5 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 117 NNRTTSEDINDRTISQKRPESTSSSDIIARTRSPSV 224 N++T S D + T S TSS + RSP V Sbjct: 129 NSQTRSFDCDSSTGSMASAPGTSSVPLTIHRRSPGV 164 >Y17699-1|CAA76819.1| 81|Anopheles gambiae hypothetical protein protein. Length = 81 Score = 22.6 bits (46), Expect = 9.6 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +2 Query: 401 ADGDKGGPR-NVRPIQSPKDQPHGQPSNF 484 +D D+ + NV SPKD+P P +F Sbjct: 35 SDSDEAAEQPNVEKDDSPKDKPDIDPVDF 63 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 567,846 Number of Sequences: 2352 Number of extensions: 10960 Number of successful extensions: 33 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -