BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30340X (585 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03230.1 68416.m00319 esterase/lipase/thioesterase family pro... 28 4.0 At5g24870.2 68418.m02943 zinc finger (C3HC4-type RING finger) fa... 28 5.3 At5g24870.1 68418.m02942 zinc finger (C3HC4-type RING finger) fa... 28 5.3 At1g73460.1 68414.m08504 protein kinase family protein contains ... 28 5.3 At5g11350.1 68418.m01325 endonuclease/exonuclease/phosphatase fa... 27 7.0 At4g22370.1 68417.m03233 hypothetical protein 27 7.0 At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, put... 27 7.0 At2g24460.1 68415.m02923 expressed protein 27 7.0 At2g04620.1 68415.m00470 cation efflux family protein potential ... 27 7.0 At2g03630.1 68415.m00323 hypothetical protein 27 7.0 At5g18620.2 68418.m02206 DNA-dependent ATPase, putative similar ... 27 9.2 At5g18620.1 68418.m02205 DNA-dependent ATPase, putative similar ... 27 9.2 >At3g03230.1 68416.m00319 esterase/lipase/thioesterase family protein contains Interpro entry IPR000379 Length = 333 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 3 KTFSTQSETHTKQSHTEHSSIKHVHSGTHKYITTSEDI 116 K T+ + + HT+HS IK Y+TT +DI Sbjct: 215 KDTMTERDLELAEKHTKHSYIKESALRQGGYVTTQQDI 252 >At5g24870.2 68418.m02943 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 520 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = +3 Query: 99 TTSEDINNRTTSEDINDRTISQKRPESTSSSDIIARTRSPSVNDRNVVRSST 254 ++S N+T + + IS + + S+ PSV D +VV SST Sbjct: 227 SSSSSRGNKTEGSVVGGKNISSPQGNGITMSEPRRNRNLPSVRDNSVVSSST 278 >At5g24870.1 68418.m02942 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 520 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = +3 Query: 99 TTSEDINNRTTSEDINDRTISQKRPESTSSSDIIARTRSPSVNDRNVVRSST 254 ++S N+T + + IS + + S+ PSV D +VV SST Sbjct: 227 SSSSSRGNKTEGSVVGGKNISSPQGNGITMSEPRRNRNLPSVRDNSVVSSST 278 >At1g73460.1 68414.m08504 protein kinase family protein contains protein kinase domain Pfam:PF00069 Length = 1169 Score = 27.9 bits (59), Expect = 5.3 Identities = 19/61 (31%), Positives = 28/61 (45%) Frame = +3 Query: 9 FSTQSETHTKQSHTEHSSIKHVHSGTHKYITTSEDINNRTTSEDINDRTISQKRPESTSS 188 FS S QS SS K + SG H+ +T + + S ++D + +R S SS Sbjct: 689 FSFGSSQKDGQSMHAESS-KSLWSGNHETVTRDRNTERLSASTAMDDMVATWRRKSSDSS 747 Query: 189 S 191 S Sbjct: 748 S 748 >At5g11350.1 68418.m01325 endonuclease/exonuclease/phosphatase family protein contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 754 Score = 27.5 bits (58), Expect = 7.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 108 EDINNRTTSEDINDRTISQKRPESTSSS 191 +D N +T+ED++ TIS P+ SS+ Sbjct: 500 DDSGNLSTAEDLSSLTISDTEPQHASSA 527 >At4g22370.1 68417.m03233 hypothetical protein Length = 205 Score = 27.5 bits (58), Expect = 7.0 Identities = 15/77 (19%), Positives = 34/77 (44%) Frame = +3 Query: 12 STQSETHTKQSHTEHSSIKHVHSGTHKYITTSEDINNRTTSEDINDRTISQKRPESTSSS 191 ST + H SH+ S++KH E I+ + ++ ++ + + E + Sbjct: 42 STNTSFHLDLSHSHRSTLKHYTRVRKSESDWEESIDEEKSDQEESEDEENDDKKEDYRAK 101 Query: 192 DIIARTRSPSVNDRNVV 242 + I + + + DRN++ Sbjct: 102 ETILKLYT-DIKDRNIM 117 >At2g28970.1 68415.m03524 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 786 Score = 27.5 bits (58), Expect = 7.0 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +3 Query: 78 SGTHKYITTSEDINNRTTSEDINDRTISQKRPESTSSSDIIARTRSPS 221 S + YITTS +INN T E S P++ S+ II PS Sbjct: 121 SSSFSYITTSLNINNSDTFEIPKAALKSAATPKNASAPLIITWKPRPS 168 >At2g24460.1 68415.m02923 expressed protein Length = 150 Score = 27.5 bits (58), Expect = 7.0 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -3 Query: 412 VAISYKIYFYIPCNSNPL 359 V ++ K+Y Y PCN++PL Sbjct: 124 VKLTQKLYTYAPCNASPL 141 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.5 bits (58), Expect = 7.0 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +3 Query: 21 SETHTKQSHTEHSSIKHVHSGTHKYITTSEDINNRTTSED 140 S++H + H EH H HS H+ + D +++ S + Sbjct: 586 SDSHKHEEHHEHDHHHHSHSHKHEECNHNHDHEHQSHSHN 625 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 21 SETHTKQSHTEHSSIKHVHSGTHKY 95 + +H+ QSH+ + H HS +HK+ Sbjct: 555 THSHSHQSHSHKNEEHHQHSDSHKH 579 >At2g03630.1 68415.m00323 hypothetical protein Length = 252 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +3 Query: 15 TQSETHTKQSHTEHSSIKHVHSGTHKYITTSEDINNRTTSEDINDRTIS 161 T++ +SH+ SS S + Y++ +D+ E +ND IS Sbjct: 42 TETVIINSESHSRLSSSSSSSSSSSSYLSPPKDLPEEVLKESLNDPEIS 90 >At5g18620.2 68418.m02206 DNA-dependent ATPase, putative similar to DNA-dependent ATPase SNF2H [Mus musculus] GI:14028669; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00249: Myb-like DNA-binding domain Length = 1072 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -3 Query: 361 LTASKFLFRYK*DRHLDRRTNIINVLDVCFVYNFSTVDDRTTLRSFT 221 L A KFL + RH+ + D+C + ++TTLR F+ Sbjct: 269 LRAVKFLGNPEERRHIREELLVAGKFDICVTSFEMAIKEKTTLRRFS 315 >At5g18620.1 68418.m02205 DNA-dependent ATPase, putative similar to DNA-dependent ATPase SNF2H [Mus musculus] GI:14028669; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00249: Myb-like DNA-binding domain Length = 1069 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -3 Query: 361 LTASKFLFRYK*DRHLDRRTNIINVLDVCFVYNFSTVDDRTTLRSFT 221 L A KFL + RH+ + D+C + ++TTLR F+ Sbjct: 269 LRAVKFLGNPEERRHIREELLVAGKFDICVTSFEMAIKEKTTLRRFS 315 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,862,698 Number of Sequences: 28952 Number of extensions: 242178 Number of successful extensions: 763 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -