BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30339 (385 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 20 7.4 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 20 7.4 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 20 9.7 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 20.2 bits (40), Expect = 7.4 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -2 Query: 198 GGATLKTLSRNLLKILGIPFEIAPAYARCSW 106 G A ++TL ++ +L P Y C W Sbjct: 267 GKAKVRTLKMTIIIVLVFFVCWTPYYVMCIW 297 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 20.2 bits (40), Expect = 7.4 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -2 Query: 198 GGATLKTLSRNLLKILGIPFEIAPAYARCSW 106 G A ++TL ++ +L P Y C W Sbjct: 267 GKAKVRTLKMTIIIVLVFFVCWTPYYVMCIW 297 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 19.8 bits (39), Expect = 9.7 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +2 Query: 218 IYEGVEREHHRLYGRTLLI 274 +++ + EH+RLY ++LI Sbjct: 140 LWKQLRYEHYRLYQLSVLI 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,675 Number of Sequences: 336 Number of extensions: 1536 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8014124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -