BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30339 (385 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1041 - 10711362-10711428,10711571-10712262,10712622-107127... 30 0.72 05_07_0042 - 27265687-27267159 29 1.3 10_07_0045 + 12328388-12328419,12328504-12328645,12328862-123290... 29 1.7 01_06_0624 - 30683249-30684631 28 2.9 06_01_0779 - 5823389-5823787 27 5.1 01_05_0225 - 19501643-19501903,19503974-19504477 27 5.1 12_02_0979 - 25009721-25009975,25010058-25010127,25010216-250103... 27 6.7 01_05_0099 - 18098169-18098390,18098878-18098972,18099063-180991... 27 6.7 >12_01_1041 - 10711362-10711428,10711571-10712262,10712622-10712777, 10712885-10713957,10714422-10714524,10714694-10714876, 10715007-10715099,10715379-10715564,10716530-10716793 Length = 938 Score = 29.9 bits (64), Expect = 0.72 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 193 GYFKNALTKSSEDIRNTI*NSSSICSLFMGRYLVGDKTPNFS 68 G+F N L + R+ + N+ SI SL Y +G P+F+ Sbjct: 310 GFFANTLKRHGRGERSDVGNNDSIESLLDPEYALGKDAPDFT 351 >05_07_0042 - 27265687-27267159 Length = 490 Score = 29.1 bits (62), Expect = 1.3 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 165 LLKILGIPFEIAPAYARCSWADIL 94 ++ ++ +PF + P YA+C W D L Sbjct: 178 VMAMVELPFMVRPEYAQCLWGDTL 201 >10_07_0045 + 12328388-12328419,12328504-12328645,12328862-12329054, 12329224-12329320,12329404-12329528,12329616-12329734, 12331225-12331298,12331359-12331413,12331450-12331500, 12331611-12331857,12331940-12332036,12332170-12332244, 12334286-12334488,12334757-12334905,12334995-12335168, 12335276-12335401,12335493-12335623,12335743-12335818, 12335898-12336027,12336115-12336193,12336267-12336465, 12336591-12336698,12336769-12337025,12337267-12337282 Length = 984 Score = 28.7 bits (61), Expect = 1.7 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +2 Query: 203 IIGYLIYEGVEREHHRLYGRTL 268 ++G LIY G E HH+LYG++L Sbjct: 380 VVGVLIYVG-EIHHHQLYGQSL 400 >01_06_0624 - 30683249-30684631 Length = 460 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -2 Query: 243 CSLSTPSYIKYPMMKGGATLKTLSRNLLKILGI 145 C+ + SY+ P+M+ + + R+LL+I G+ Sbjct: 121 CASALASYLHIPVMRSAVSFGQMGRSLLRIPGV 153 >06_01_0779 - 5823389-5823787 Length = 132 Score = 27.1 bits (57), Expect = 5.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 156 ILGIPFEIAPAYARCSWADIL*VTRPRILASSP 58 +LGIP +RC W VT PR++ S+P Sbjct: 67 VLGIP--ATTTASRCCWTSWWIVTAPRMMLSAP 97 >01_05_0225 - 19501643-19501903,19503974-19504477 Length = 254 Score = 27.1 bits (57), Expect = 5.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 250 SVMLPFNSFIYQVSNDEGRGYFKNALTKSSEDIRNTI 140 S +LP+ + VSN+E + + KSS+D R +I Sbjct: 158 SPLLPWRDSLVMVSNEEYKSVEHRVVIKSSQDARVSI 194 >12_02_0979 - 25009721-25009975,25010058-25010127,25010216-25010381, 25010501-25010651,25010843-25010890,25011172-25011225, 25011400-25011513,25012666-25012782,25012899-25012991, 25013085-25013123,25013990-25014055 Length = 390 Score = 26.6 bits (56), Expect = 6.7 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 89 TYKISAHEQRAYAGAISNGIPNIFRRFRESVFKV 190 TYK+SAH + Y + I RRF+ F+V Sbjct: 323 TYKLSAHLRHNYLTVFTIAALEILRRFQWVFFRV 356 >01_05_0099 - 18098169-18098390,18098878-18098972,18099063-18099131, 18099277-18099352,18101412-18101524,18104137-18104185, 18104540-18104572,18105446-18105552,18106892-18106990, 18107122-18107203 Length = 314 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 143 GIPNIFRRFRESVFKVAPPFIIGYLIYEGVEREHHRL 253 GIP +R ++ + P +I + YE + R H+L Sbjct: 275 GIPGFYRGCATNLLRTTPNAVITFTSYEMINRLMHQL 311 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,331,221 Number of Sequences: 37544 Number of extensions: 153085 Number of successful extensions: 309 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 309 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 636799876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -