BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30339 (385 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_948| Best HMM Match : Sec62 (HMM E-Value=9.5) 28 2.3 SB_47383| Best HMM Match : LON (HMM E-Value=1.3) 28 3.0 SB_29518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_32937| Best HMM Match : MFS_1 (HMM E-Value=5e-35) 27 5.2 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_12740| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) 27 6.9 SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_37699| Best HMM Match : Peptidase_M13_N (HMM E-Value=0) 26 9.2 >SB_948| Best HMM Match : Sec62 (HMM E-Value=9.5) Length = 306 Score = 28.3 bits (60), Expect = 2.3 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -1 Query: 223 IYQVSNDEGRGYFKNALTKSSEDIRNT 143 +Y+ +ND G YFK+ +++ D R + Sbjct: 55 VYRAANDNGESYFKSIFKRAANDNRES 81 Score = 27.9 bits (59), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 235 FNSFIYQVSNDEGRGYFKNALTKSSEDIRNTI*NSSSI 122 F S + +ND G YFK+ +++ D R + SS + Sbjct: 17 FRSIFDRAANDNGESYFKSIFKRAANDNRESNFKSSVV 54 >SB_47383| Best HMM Match : LON (HMM E-Value=1.3) Length = 1528 Score = 27.9 bits (59), Expect = 3.0 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -2 Query: 267 RVLPYSL*CSLSTPSYIKYPMMKGGATLKTLSRNLLKILG 148 RV+ ++ C LS S K P+ LK SR LKI+G Sbjct: 1013 RVIKQAIRCKLSITSSKKLPINTASNILKYFSRFPLKIIG 1052 >SB_29518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 27.9 bits (59), Expect = 3.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 235 FNSFIYQVSNDEGRGYFKNALTKSSEDIRNTI*NSSSI 122 F S + +ND G YFK+ +++ D R + SS + Sbjct: 166 FRSIFDRAANDNGESYFKSIFKRAANDNRESNFKSSVV 203 >SB_32937| Best HMM Match : MFS_1 (HMM E-Value=5e-35) Length = 482 Score = 27.1 bits (57), Expect = 5.2 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -1 Query: 226 FIYQVSNDEGRGYF--KNALTKSSEDIRNT 143 F Y + + EG+G+F K+ L +S + I+NT Sbjct: 397 FFYGIYDSEGKGFFCRKSCLEESKQVIQNT 426 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 27.1 bits (57), Expect = 5.2 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 215 LIYEGVEREHHRLYGRTLLILKMINKHSLQIK 310 L+ + H RLYGR+ ++L++ N L+I+ Sbjct: 730 LLVSNITTLHERLYGRSRIVLRVRNIAPLRIR 761 >SB_12740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1306 Score = 27.1 bits (57), Expect = 5.2 Identities = 12/44 (27%), Positives = 26/44 (59%) Frame = -1 Query: 289 IDHFQNQQGSSV*SVMLPFNSFIYQVSNDEGRGYFKNALTKSSE 158 +D F++ + + ++L +N+ ++ DEG +F+N L +SE Sbjct: 878 VDPFEDDETLTDDYIVLSYNTECVHLAIDEGPRFFQNKLAVNSE 921 >SB_36169| Best HMM Match : DUF676 (HMM E-Value=0) Length = 2442 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 229 SFIYQVSNDEGRGYFKNALTKSS 161 +F+Y++S G YFKN L SS Sbjct: 974 TFLYKLSRSSGLEYFKNILLVSS 996 >SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 26.6 bits (56), Expect = 6.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 140 NGIPNIFRRFRESVFKVAPPFIIGYLIYEGV 232 +G ++R + KVAP I Y++YE + Sbjct: 381 DGFKGLYRGLAPNFLKVAPAVSISYVVYENL 411 >SB_37699| Best HMM Match : Peptidase_M13_N (HMM E-Value=0) Length = 876 Score = 26.2 bits (55), Expect = 9.2 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 200 FIIGYLIYEGVEREHHRLYGRTLLILKMINKHSLQ 304 FI + Y+GV +++ L+ + ILKM +K L+ Sbjct: 669 FIKRFKKYKGVTMKNNALFANRIAILKMAHKRMLK 703 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,635,598 Number of Sequences: 59808 Number of extensions: 174070 Number of successful extensions: 356 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 356 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 656970245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -