BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30339 (385 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 0.93 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 4.9 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 4.9 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 4.9 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 4.9 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 4.9 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 4.9 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 4.9 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 4.9 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 4.9 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 4.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 4.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 4.9 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 4.9 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 4.9 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 4.9 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 4.9 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 4.9 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 4.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 4.9 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 4.9 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 4.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 4.9 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 4.9 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 4.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 6.5 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 20 8.6 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 23.4 bits (48), Expect = 0.93 Identities = 15/55 (27%), Positives = 27/55 (49%) Frame = -2 Query: 165 LLKILGIPFEIAPAYARCSWADIL*VTRPRILASSPKCLPIVVNF*LLNFAIKSY 1 L ILG+PFE++ + + W L + + R S V+ ++ F+I+ Y Sbjct: 81 LFLILGLPFELSVFWQQYPWQWGLGICKLRAYVSETSSYVSVLT--IVAFSIERY 133 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHERLMKKMIL 62 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHERLMKKMIL 62 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHERLMKKMIL 62 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHERLMKKMIL 62 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHERLMKKMIL 62 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHERLMKKMIL 62 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHERLMKKMIL 62 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHERLMKKMIL 62 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLMKKMIL 62 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.6 bits (41), Expect = 6.5 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 212 YLIYEGVEREHHRLYGRTLL 271 +LI + EREH RL + +L Sbjct: 43 WLIQQEREREHQRLTKKMIL 62 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 20.2 bits (40), Expect = 8.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = -1 Query: 232 NSFIYQVSNDEGRGYFKNALTKSSEDI 152 N+FI ++ D G+G +A S+++ Sbjct: 187 NTFIANIAVDLGKGGCNDAFAYMSDEL 213 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,437 Number of Sequences: 438 Number of extensions: 1589 Number of successful extensions: 27 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9424380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -