BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30339 (385 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g10440.1 68418.m01210 cyclin family protein similar to cyclin... 28 1.9 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 28 2.5 At2g35070.1 68415.m04302 expressed protein 27 3.3 At2g32760.1 68415.m04008 expressed protein 27 3.3 At2g32295.1 68415.m03948 EXS family protein / ERD1/XPR1/SYG1 fam... 27 4.3 At5g64070.1 68418.m08046 phosphatidylinositol 4-kinase (PI4K) ne... 27 5.7 At5g35230.1 68418.m04177 hypothetical protein 27 5.7 At2g35090.1 68415.m04305 hypothetical protein 27 5.7 At4g23510.1 68417.m03388 disease resistance protein (TIR class),... 26 7.5 At5g51530.1 68418.m06390 ubiquitin carboxyl-terminal hydrolase-r... 26 9.9 At3g47470.1 68416.m05162 chlorophyll A-B binding protein 4, chlo... 26 9.9 >At5g10440.1 68418.m01210 cyclin family protein similar to cyclin D2.1 protein [Nicotiana tabacum] GI:4160298; contains Pfam profile PF00134: Cyclin, N-terminal domain Length = 298 Score = 28.3 bits (60), Expect = 1.9 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 111 NNEHMLELFQMVFLISSEDFVRAFLK*PRPSSLDT*YMKELKGSITDY 254 N+ +FQM F + SE+ VR ++ R S Y+K L+ D+ Sbjct: 19 NSVDTRSIFQMGFPLESEEIVREMIEKERQHSPRDDYLKRLRNGDLDF 66 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 27.9 bits (59), Expect = 2.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 143 GIPNIFRRFRESVFKVAPPFIIGYLIYEGVER 238 G+ +R + FKV P I YL+YE +++ Sbjct: 442 GLKGFYRGIFPNFFKVIPSASISYLVYEAMKK 473 >At2g35070.1 68415.m04302 expressed protein Length = 158 Score = 27.5 bits (58), Expect = 3.3 Identities = 10/47 (21%), Positives = 23/47 (48%) Frame = +2 Query: 47 GKHFGELAKIRGLVTYKISAHEQRAYAGAISNGIPNIFRRFRESVFK 187 G H +L ++ L + + + A GAI++G ++ + + + K Sbjct: 25 GNHVDKLGMVKALEAINVPSTQAEALTGAITSGFESVMGKVKADIAK 71 >At2g32760.1 68415.m04008 expressed protein Length = 352 Score = 27.5 bits (58), Expect = 3.3 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -2 Query: 198 GGATL--KTLSRNLLKILGIPFEIAP 127 GG+ L K LS+ ++ILG+PF +AP Sbjct: 187 GGSRLGTKPLSQGSVRILGLPFSMAP 212 >At2g32295.1 68415.m03948 EXS family protein / ERD1/XPR1/SYG1 family protein low similarity to xenotropic and polytropic murine leukemia virus receptor [Mustela vison] GI:6093316; contains Pfam profile PF03124: EXS family Length = 424 Score = 27.1 bits (57), Expect = 4.3 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 74 IRGLVTYKISAHEQRAYAGAISNGIPNIFRRFRESVFKV 190 +R TYK+SAH + Y I+RRF+ + F++ Sbjct: 344 LRWTWTYKLSAHLRNNYITVFIITALEIYRRFQWAFFRI 382 >At5g64070.1 68418.m08046 phosphatidylinositol 4-kinase (PI4K) nearly identical to gi:4467359 Length = 1121 Score = 26.6 bits (56), Expect = 5.7 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -1 Query: 205 DEGRGYFKNALTKSSEDIRNTI*NSSSICSLFMGRYLVGDKTPNFS*FSKVF 50 DE G+FK + S+D ++ I + G GD++P FS F ++F Sbjct: 420 DEREGFFKKFFKEKSDDKKD-------IVKVDDGNESEGDESPEFSLFKRLF 464 >At5g35230.1 68418.m04177 hypothetical protein Length = 366 Score = 26.6 bits (56), Expect = 5.7 Identities = 17/70 (24%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = -1 Query: 328 ISTLNNFNLQTMFIDHFQNQQGSSV*SVMLPFNSFI-YQVSNDEGRGYFKNALTKSSEDI 152 +S + ++TM + + Q ++ S M+P NS++ Y + D G L+K+S+ + Sbjct: 278 LSVAISSGMETMQYEELKTQYEKTLRSCMIPSNSYLQYTLIRDGGNLEHLLTLSKNSQTL 337 Query: 151 RNTI*NSSSI 122 + S S+ Sbjct: 338 LCKVCGSPSL 347 >At2g35090.1 68415.m04305 hypothetical protein Length = 124 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/44 (22%), Positives = 23/44 (52%) Frame = +2 Query: 47 GKHFGELAKIRGLVTYKISAHEQRAYAGAISNGIPNIFRRFRES 178 G H +L ++ L + + + A GAI++G+ ++ + +S Sbjct: 25 GNHVDKLGMVKALEAINVPSTQAEALTGAITSGLESVVEKEYQS 68 >At4g23510.1 68417.m03388 disease resistance protein (TIR class), putative domain signature TIR exists, suggestive of a disease resistance protein. Length = 635 Score = 26.2 bits (55), Expect = 7.5 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 3/42 (7%) Frame = -1 Query: 244 MLPFNSFIYQVSNDEGR---GYFKNALTKSSEDIRNTI*NSS 128 ++PF F Y+V + + G+F+N L K+ ED+R + S+ Sbjct: 96 IVPFPIF-YKVKAESVKNQTGHFRNVLLKTEEDVRKKVDRSN 136 >At5g51530.1 68418.m06390 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1149 Score = 25.8 bits (54), Expect = 9.9 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -1 Query: 229 SFIYQVSNDEGRGYFKNALTKSSEDIRNTI*NSSSIC 119 SF+ V N EGR F+ LT + D + T S C Sbjct: 215 SFVEGVHNREGRDVFEKVLTSAKADRKWTFWMCRSKC 251 >At3g47470.1 68416.m05162 chlorophyll A-B binding protein 4, chloroplast / LHCI type III CAB-4 (CAB4) identical to SP|P27521 Chlorophyll A-B binding protein 4, chloroplast precursor (LHCI type III CAB-4) (LHCP) {Arabidopsis thaliana} Length = 251 Score = 25.8 bits (54), Expect = 9.9 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 244 MLPFNSFIYQVSNDEGRGYFKNALTKSSEDIRNTI 140 ML F F+ Q N G+G F+N L S+ NTI Sbjct: 213 MLAFLGFVVQ-HNVTGKGPFENLLQHLSDPWHNTI 246 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,970,697 Number of Sequences: 28952 Number of extensions: 131515 Number of successful extensions: 275 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 274 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 537681456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -