BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30335 (494 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.0 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 2.0 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 3.5 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 8.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.1 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 8.1 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.6 bits (46), Expect = 2.0 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +1 Query: 304 RHQYCQSWILQVARQRQTPQTTCHSKS 384 RH ++W+ R + TPQ+ S++ Sbjct: 237 RHLERKAWVASFGRPKMTPQSLLPSQT 263 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.6 bits (46), Expect = 2.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +3 Query: 153 HPGYFGKLGMRNFHFRKNKNFCPVLNLDKLWTLVL 257 HP YFGK G + K +C + L L V+ Sbjct: 303 HPTYFGKTGRKT--VLKTNKYCNFIILFYLSVFVI 335 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 3.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 224 NWTEILVLSKVEISHTKF 171 +WTEI + V S TKF Sbjct: 60 SWTEINAFANVSPSKTKF 77 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 20.6 bits (41), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 375 MTGCLGSLPLPSNL*YPALTILMTGTL 295 MTG +P S + Y ILM GT+ Sbjct: 271 MTGTKTVMPSQSAIKYRKQVILMLGTV 297 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.1 Identities = 8/35 (22%), Positives = 17/35 (48%) Frame = -3 Query: 315 ILMTGTLPSGADAYFSLVCSGLMSKAYLSSKLDRN 211 +L + G + + +++AY + K+DRN Sbjct: 72 VLGAAVVSKGTTLFMTSQIKKNVTRAYCNKKIDRN 106 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 8.1 Identities = 8/35 (22%), Positives = 17/35 (48%) Frame = -3 Query: 315 ILMTGTLPSGADAYFSLVCSGLMSKAYLSSKLDRN 211 +L + G + + +++AY + K+DRN Sbjct: 72 VLGAAVVSKGTTLFMTSQIKKNVTRAYCNKKIDRN 106 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 20.6 bits (41), Expect = 8.1 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -2 Query: 106 PRPPGCLRCFPIRP 65 P P G L +P RP Sbjct: 65 PSPRGALGAYPFRP 78 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,875 Number of Sequences: 336 Number of extensions: 2146 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11630247 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -