BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30335 (494 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23290.1 68414.m02913 60S ribosomal protein L27A (RPL27aB) si... 108 2e-24 At1g70600.1 68414.m08133 60S ribosomal protein L27A (RPL27aC) id... 105 2e-23 At1g12960.1 68414.m01505 60S ribosomal protein L27A (RPL27aA) si... 49 2e-06 At2g16100.1 68415.m01846 hypothetical protein 29 2.3 At5g58750.1 68418.m07359 wound-responsive protein-related simila... 28 3.0 At4g29090.1 68417.m04163 reverse transcriptase, putative / RNA-d... 27 5.3 At3g07990.1 68416.m00976 serine carboxypeptidase S10 family prot... 27 9.2 >At1g23290.1 68414.m02913 60S ribosomal protein L27A (RPL27aB) similar to 60S RIBOSOMAL PROTEIN L27A GB:P49637 GI:1710530 from [Arabidopsis thaliana] Length = 146 Score = 108 bits (259), Expect = 2e-24 Identities = 49/82 (59%), Positives = 55/82 (67%) Frame = +3 Query: 9 MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 188 MAT+ KK RK RGHVS NAGG HHHRI DKYHPGYFGK+GMR Sbjct: 1 MATALKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60 Query: 189 FHFRKNKNFCPVLNLDKLWTLV 254 FH +NK FCP++NLDKLW+LV Sbjct: 61 FHKLRNKFFCPIVNLDKLWSLV 82 >At1g70600.1 68414.m08133 60S ribosomal protein L27A (RPL27aC) identical to 60S ribosomal protein L27A GB:P49637 [Arabidopsis thaliana] Length = 146 Score = 105 bits (252), Expect = 2e-23 Identities = 48/82 (58%), Positives = 53/82 (64%) Frame = +3 Query: 9 MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGKLGMRN 188 M T KK RK RGHVS NAGG HHHRI DKYHPGYFGK+GMR Sbjct: 1 MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60 Query: 189 FHFRKNKNFCPVLNLDKLWTLV 254 FH +NK FCP++NLDKLW+LV Sbjct: 61 FHKLRNKFFCPIVNLDKLWSLV 82 >At1g12960.1 68414.m01505 60S ribosomal protein L27A (RPL27aA) similar to GB:BAA96068 from [Panax ginseng] Length = 104 Score = 48.8 bits (111), Expect = 2e-06 Identities = 33/87 (37%), Positives = 43/87 (49%), Gaps = 2/87 (2%) Frame = +3 Query: 9 MATSKKKTRKLRGHVSXXXXXXXXXXXXXXXXXNAGGEHHHRINMDKYHPGYFGK--LGM 182 M TS+KKTR LR HVS H R + PG G +GM Sbjct: 1 MTTSRKKTRNLREHVSVG---------------------HGRFGKHRKLPGSRGNAGVGM 39 Query: 183 RNFHFRKNKNFCPVLNLDKLWTLVLNR 263 R FH +NK +C ++NLDKLW++VL + Sbjct: 40 RYFHKLRNKFYCQIVNLDKLWSMVLGK 66 >At2g16100.1 68415.m01846 hypothetical protein Length = 250 Score = 28.7 bits (61), Expect = 2.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 122 APSQNQHGQVPSWILWQTW 178 +P +Q Q+P WILW+ W Sbjct: 20 SPRTSQFHQLPLWILWRIW 38 >At5g58750.1 68418.m07359 wound-responsive protein-related similar to induced upon wounding stress [Arabidopsis thaliana] GI:1483218 Length = 386 Score = 28.3 bits (60), Expect = 3.0 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +2 Query: 149 VPSWILWQTWYEKFPL*KEQEFL-SSFELR*ALD-ISPEQTRLKYASAPDGKVPVINIVK 322 + S + W TW +FPL ++ + + L ALD I P RLK+ S G +++V+ Sbjct: 84 IVSHVFWVTWSGEFPLDTDECCVQNKTMLMNALDAILPNAKRLKHFSLQTGMKHYVSLVE 143 >At4g29090.1 68417.m04163 reverse transcriptase, putative / RNA-dependent DNA polymerase, putative similar to reverse transcriptase [Arabidopsis thaliana] GI:976278; contains Pfam profile PF00075: RNase H Length = 575 Score = 27.5 bits (58), Expect = 5.3 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +2 Query: 125 PSQNQHGQVPSWILWQTWYEKFPL-*KEQEFLSSFELR*ALDISPEQTRLKYASAPDGKV 301 P + Q+ W+LW+ W + L + +EF + LR A D E+ R++ + G Sbjct: 351 PQWEKASQLVPWLLWRLWKNRNELVFRGREFNAQEVLRRAED-DLEEWRIRTEAESCGTK 409 Query: 302 PVIN 313 P +N Sbjct: 410 PQVN 413 >At3g07990.1 68416.m00976 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase II (CP-MII) GB:CAA70815 [Hordeum vulgare] Length = 459 Score = 26.6 bits (56), Expect = 9.2 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +2 Query: 155 SWILWQTWYEKFPL*KEQEFLSSFELR*ALDISPEQTRLKYASAPDGKVPVINI 316 S+I W+E+FP K +EF E A P+ ++L + K P IN+ Sbjct: 159 SYIFLVNWFERFPQYKHREFYIVGESY-AGHFVPQLSKLVHERNKGFKNPAINL 211 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,653,364 Number of Sequences: 28952 Number of extensions: 191123 Number of successful extensions: 469 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 868578304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -