BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30334X (376 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48378| Best HMM Match : Ribosomal_S6e (HMM E-Value=0) 76 1e-14 SB_47786| Best HMM Match : Ank (HMM E-Value=4.4e-30) 36 0.011 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.93 SB_51108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.93 SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) 29 1.2 SB_37092| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) 27 6.5 SB_22145| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_36564| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_7395| Best HMM Match : SURF6 (HMM E-Value=1.8) 26 8.7 >SB_48378| Best HMM Match : Ribosomal_S6e (HMM E-Value=0) Length = 212 Score = 75.8 bits (178), Expect = 1e-14 Identities = 39/82 (47%), Positives = 46/82 (56%) Frame = +3 Query: 126 EVEADQLGDEWKGYVLRVAXGNDKQGFPMKHGVLTNSRVRLLMQMATHVTYRSAMERENV 305 EV + LGDEWKGYV R+ GNDKQGFPMK G++TN RVRLL+ H YR E Sbjct: 2 EVSGECLGDEWKGYVFRITGGNDKQGFPMKQGIMTNGRVRLLLSKG-HSCYRPRRTGERK 60 Query: 306 NHFVDVLLTPISRSWLLLLCAK 371 V + S L L+ K Sbjct: 61 RKSVRGCIVDSQLSVLSLVIVK 82 Score = 66.9 bits (156), Expect = 5e-12 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +2 Query: 254 ANGHSCYIPLRDGERKRKSFRGCIVDANLSVLALVIVRKG 373 + GHSCY P R GERKRKS RGCIVD+ LSVL+LVIV+KG Sbjct: 45 SKGHSCYRPRRTGERKRKSVRGCIVDSQLSVLSLVIVKKG 84 >SB_47786| Best HMM Match : Ank (HMM E-Value=4.4e-30) Length = 796 Score = 35.9 bits (79), Expect = 0.011 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = -3 Query: 251 QKTNTAVCQDAMFHRESLLVVAASDTKYIALPFIA*LISLYFGAHALFVK 102 Q+ + A+ D + H +SL V+ SD + ++LP I + Y H L ++ Sbjct: 257 QEADAAIGHDPLLHGKSLFVITTSDPEDVSLPLIPQALPRYLHGHTLVIE 306 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 29.5 bits (63), Expect = 0.93 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 258 FASEDEHGCLSGRHVSSGILACRCRXRHEVHSPSIHRL 145 F+S DE+ H+ +G++ CR EVH I R+ Sbjct: 1033 FSSNDEYARYVRDHIQTGMMVRCCRTYEEVHEGDIGRV 1070 >SB_51108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 29.5 bits (63), Expect = 0.93 Identities = 10/25 (40%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = +2 Query: 200 RIPDETWR--PDKQPCSSSDANGHS 268 ++P+ETW+ P+K C++ + NG S Sbjct: 60 KLPNETWKFSPEKDSCTADEVNGFS 84 >SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) Length = 592 Score = 29.1 bits (62), Expect = 1.2 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +2 Query: 203 IPDETWRPDKQPCSSSDANGHSCYIPLRDGERK 301 + ++ +P KQ +S A+GH+ Y PL+DGE + Sbjct: 142 VQEKARKPTKQ--ASGVAHGHTYYEPLKDGESR 172 >SB_37092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 26.6 bits (56), Expect = 6.5 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 102 FYEKRMGAEVEADQLGDEWKGYVL-RVAXGNDKQG 203 FY K++ ++ L +EW+ +V +A G DK G Sbjct: 10 FYNKKLEDYMKNTSLNEEWQDWVRHNIAAGCDKNG 44 >SB_34068| Best HMM Match : rve (HMM E-Value=5.7e-05) Length = 1081 Score = 26.6 bits (56), Expect = 6.5 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -2 Query: 153 HRLTDQPLLRRPCAFRKRYEACARPPLRTTSGIPLP 46 H ++ + L RR A R+ ACAR P ++ P+P Sbjct: 698 HFMSCKTLGRRSLASRRDARACARAPKMPSAHTPVP 733 >SB_22145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 26.6 bits (56), Expect = 6.5 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +2 Query: 230 KQPCSSSDANGHSCYIP---LRDGERK-RKSFRGCIVDANLS 343 K+PCS + + HS IP L +RK + RGC V LS Sbjct: 47 KRPCSDAGCHRHSMVIPDPYLDQTQRKLLRQKRGCRVHRRLS 88 >SB_44749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2250 Score = 26.6 bits (56), Expect = 6.5 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 161 GLCTSCRXRQRQARIPDETW-RPDKQPCSSSDANG 262 G+ CR R+ R D+TW PD+ P S +G Sbjct: 1728 GIDRECRSIDRECRCIDDTWNNPDEFPRSFIKGSG 1762 >SB_36564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 422 Score = 26.6 bits (56), Expect = 6.5 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -2 Query: 222 RHVSSGILACRCRXRHEVHSPSIHR---LTDQPLLRRPCAFR 106 RH + +L C RH P +R +TD PLL+ PC +R Sbjct: 216 RHPAIPLLQTPCYYRH----PRYYRHPTITDIPLLQTPCYYR 253 >SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.6 bits (56), Expect = 6.5 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -3 Query: 134 LYFGAHALFVKDTKL-VLVHHFEQLLASRCRVRN 36 LY+ H +F + VL H+ + L R R+RN Sbjct: 72 LYYATHPVFFSSRAVYVLTHNLSKNLGYRARIRN 105 >SB_7395| Best HMM Match : SURF6 (HMM E-Value=1.8) Length = 1365 Score = 26.2 bits (55), Expect = 8.7 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 132 EADQLGDEWKGYVL-RVAXG-NDKQGFPMK 215 E D+ G EW+G+V + G D QG+ MK Sbjct: 815 EEDRTGQEWEGHVCDKEPEGKRDNQGYKMK 844 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,805,553 Number of Sequences: 59808 Number of extensions: 268159 Number of successful extensions: 788 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 619783250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -