BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30334X (376 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 25 0.70 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 25 0.70 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 25 1.2 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 25 1.2 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 24 1.6 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 24 2.1 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 2.1 AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 23 2.8 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 22 6.5 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 22 8.7 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 22 8.7 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 25.4 bits (53), Expect = 0.70 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 158 PFIA*LISLYFGAHALFVKDTKLVLVHHFEQLLASRCRVRNV 33 PFIA + + G L + L+H F QL+A R R RNV Sbjct: 265 PFIADHVLVNVGTVDLLHGRAMIDLIHDFNQLVA-RFRERNV 305 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 25.4 bits (53), Expect = 0.70 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = -2 Query: 375 APLRTITRAKTERLASTIHPR 313 APLR+I + +++A+++HPR Sbjct: 417 APLRSIGLTELDQIAASMHPR 437 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 24.6 bits (51), Expect = 1.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 138 QPLLRRPCAFRKRYEACAR 82 Q +RR CAF K++EA R Sbjct: 379 QAHIRRHCAFAKQFEALCR 397 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 24.6 bits (51), Expect = 1.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 138 QPLLRRPCAFRKRYEACAR 82 Q +RR CAF K++EA R Sbjct: 410 QAHIRRHCAFAKQFEALCR 428 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 24.2 bits (50), Expect = 1.6 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 4/61 (6%) Frame = +3 Query: 177 VAXGNDKQGFPMKHGVLTNSRVR-LLMQMATHVTYRSAMERENVNHFVDVL---LTPISR 344 VA + P+ HG LTN R LL ++ R A V + VL L PI R Sbjct: 797 VADSTMRYAAPVWHGALTNRECRSLLKRVQRKAAIRVARTFRTVRYETAVLPAGLVPICR 856 Query: 345 S 347 + Sbjct: 857 A 857 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 23.8 bits (49), Expect = 2.1 Identities = 12/52 (23%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +2 Query: 206 PD-ETWRPDKQPCSSSDANGHSCYIPLRDGERKRKSFRGCIVDANLSVLALV 358 PD E + PD+ +++ A ++P DG R R +++ ++ +V Sbjct: 417 PDPERFDPDRFALAATHARHTHAFLPFGDGPRNCIGMRFGLLEVKFGIVQMV 468 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 2.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 41 VPGNGMPEVVRSGGRAQA 94 VPG+G+P SGG A Sbjct: 3225 VPGSGLPAAAASGGAPSA 3242 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 23.4 bits (48), Expect = 2.8 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 176 CRXRQRQARIPDETWRPDKQPCSSSDANGHSCYIPLRD 289 C ++ + +P P +PC SSD G SC + D Sbjct: 66 CECKETREPLPYMYACPGTEPCQSSDRLG-SCSKSMHD 102 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 22.2 bits (45), Expect = 6.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 206 PDETWRPDKQPCSSSDAN 259 PD+ W+PD +++D N Sbjct: 105 PDKVWKPDIVLFNNADGN 122 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 21.8 bits (44), Expect = 8.7 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -2 Query: 180 RHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGIP 52 + ++HS + + RRP + + P L TTSG P Sbjct: 27 QQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTSGEP 69 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 21.8 bits (44), Expect = 8.7 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = -2 Query: 180 RHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGIP 52 + ++HS + + RRP + + P L TTSG P Sbjct: 27 QQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTSGEP 69 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 418,590 Number of Sequences: 2352 Number of extensions: 8079 Number of successful extensions: 23 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 28804305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -