BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30334X (376 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 24 0.67 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 2.1 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 2.7 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 21 6.3 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 6.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 20 8.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 20 8.3 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 20 8.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 20 8.3 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 20 8.3 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.8 bits (49), Expect = 0.67 Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = -2 Query: 201 LACRCRXRHEVHSPSIHRLTDQPLLRRP-CAFRKRYEACARPPLRTTSGIPLPGTKRLT 28 ++ R RH VHS + + + LL+R C RK R + PL ++T Sbjct: 52 ISSRRNGRHNVHSLAFGAIQLRQLLKRQLCEKRKEVSIITEDSSRKQTIDPLSSNTQIT 110 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 2.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 206 PDETWRPDKQPCSSSDAN 259 PD+ W+PD +++D N Sbjct: 105 PDKVWKPDIVLFNNADGN 122 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.8 bits (44), Expect = 2.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 114 RMGAEVEADQLGDEWKGYV 170 R+G +++D L + +GYV Sbjct: 227 RIGLRIQSDSLAENVEGYV 245 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 20.6 bits (41), Expect = 6.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 73 SNNFWHPVAGYETFN 29 +NN ++P Y TFN Sbjct: 222 TNNLFYPYPPYGTFN 236 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 20.6 bits (41), Expect = 6.3 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = +2 Query: 11 IDRSHEVKRFVPGNGMP 61 I+ +HE +++PG+ +P Sbjct: 55 INETHENVKYLPGHKLP 71 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.2 bits (40), Expect = 8.3 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -1 Query: 253 IRRRTRLFVRTPCFI 209 +R+R LF+ CF+ Sbjct: 411 LRKRKELFIAIVCFV 425 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.2 bits (40), Expect = 8.3 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -1 Query: 253 IRRRTRLFVRTPCFI 209 +R+R LF+ CF+ Sbjct: 464 LRKRKELFIAIVCFV 478 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 20.2 bits (40), Expect = 8.3 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +3 Query: 57 CQKLFEVVDEHKLRIFYEKRMGAEVEAD 140 CQ F+ + EKR G VE D Sbjct: 43 CQNWFDKFRSGDFSLKDEKRSGRPVEVD 70 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 20.2 bits (40), Expect = 8.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 94 SLCSSTTSNNFWHP 53 S SS+ N+FW P Sbjct: 376 SSISSSEENDFWQP 389 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 20.2 bits (40), Expect = 8.3 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -2 Query: 189 CRXRHEVHSPSI 154 CR RHE+ S + Sbjct: 522 CRPRHEIRSTDV 533 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,948 Number of Sequences: 438 Number of extensions: 2102 Number of successful extensions: 15 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9052365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -