BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30333 (801 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 26 0.40 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 24 1.2 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 24 1.2 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 23 2.1 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 23 2.1 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 23 2.1 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 6.5 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 21 8.7 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 25.8 bits (54), Expect = 0.40 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 502 DTLKHVLFKL-YFTLSFKCVSCMFLTVLLQSYMY 600 D + V+F L YF L+F C+S + V ++ Y Sbjct: 157 DYKQPVVFDLVYFILAFACISIAYTNVSTDAFFY 190 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 177 KLSNNFAGGRAYCEPARVGTAILTNSTAKQMFVW 76 +L F + C P R+ A N T +Q+ +W Sbjct: 99 ELEREFHRSKYLCRPRRIQMAQNLNLTERQIKIW 132 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 177 KLSNNFAGGRAYCEPARVGTAILTNSTAKQMFVW 76 +L F + C P R+ A N T +Q+ +W Sbjct: 119 ELEREFHRSKYLCRPRRIQMAQNLNLTERQIKIW 152 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 177 KLSNNFAGGRAYCEPARVGTAILTNSTAKQMFVW 76 +L F + C P R+ A + T +Q+ VW Sbjct: 18 ELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVW 51 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 23.4 bits (48), Expect = 2.1 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +2 Query: 146 ALPPAKLLLNFESIISIRYYLPLMVLDLISISFFGQMIVRVQSLHSIKQSRFLCP 310 AL P +L+ +I + + + + L+++ F G I R + L +KQ R L P Sbjct: 62 ALSPFELI-QIRTINFVATFRTIANIILMAVLFLGTFIGRAKFLAILKQMRNLEP 115 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 177 KLSNNFAGGRAYCEPARVGTAILTNSTAKQMFVW 76 +L F + C P R+ A + T +Q+ VW Sbjct: 149 ELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVW 182 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 6.5 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 517 VLFKLYFTLSFKCVSCMFLTVLLQSYMYYDIDFFTL 624 ++F ++F L F+ +L Y YY FT+ Sbjct: 90 IIFTVHFLLCTYYFYYAFIILLCVYYFYYAFIIFTV 125 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/29 (24%), Positives = 15/29 (51%) Frame = +2 Query: 194 IRYYLPLMVLDLISISFFGQMIVRVQSLH 280 + +Y P+ + ++FFG + + S H Sbjct: 110 VHFYYPVATMSFYVLNFFGSIQFIIISKH 138 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,643 Number of Sequences: 336 Number of extensions: 4073 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -