BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30333 (801 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30173| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_45686| Best HMM Match : T-box (HMM E-Value=0) 28 7.7 SB_22098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_30173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 5 KSHNCRHGGKVATVLYI-GCPTLKTQTNICFAVEFVRM 115 K HN G K T+LY+ G P ++ TN V F+R+ Sbjct: 58 KPHNVEPGVKYPTILYVYGGPQVQLVTNSHKGVRFLRL 95 >SB_45686| Best HMM Match : T-box (HMM E-Value=0) Length = 947 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 98 VEFVRMAVPTRAGSQYALPPAKLLLNFESI 187 V+ ++ P+RA SQ ALPP+ LL+F + Sbjct: 491 VKLLQPQTPSRALSQRALPPSLSLLSFRPV 520 >SB_22098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 976 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +2 Query: 182 SIISIRYYLPLMVLDLISISFFGQMIVRVQSLHSIKQSRFLCPYIPM 322 ++I +YYL L D++ ++F + + S +S + + F Y+P+ Sbjct: 907 ALIRYKYYLFLRPADILLLNFISESALTFSSHNSSRIALFFFAYVPI 953 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,883,253 Number of Sequences: 59808 Number of extensions: 483431 Number of successful extensions: 1025 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1023 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -